KEGG   Ustilago maydis: UM01273.1Help
Entry
UM01273.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     UM01273.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UM01273.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 756 aa AA seqDB search
MADVVRRPSSQADSGSGSRSYSQSPQKKNGLHRSDSLSSPTKKASISNGQPKKSSSVSSL
PSSPSKEERKKLAKEILASGGDQLRHTLKQRGMLHALLSEPVKFIKSNQKQGQDYTTLGL
TPVNDPDFAAVQKRKQEQKQHALLLHTDSPKINGNTHTSDSDLSVEAQSSPSKSGKARSR
DLYPYKLSLRFPGKVRGVATGLSNYGNTCYMNSVMQSLIHTPPLAFALLTQDLDALHGEL
GGKPNVAFDAVAAMQTFAKGSLMGSKPTNAPRDFNRNLKAFARPLRQGRQEDAHEYLRFL
LEALQQGCLSRASKSLKPDDPIRATSFVQKIFGGKLRSRVTCHKCGHNSDTFDPFMDLSL
DVRKGINSLTDAFRAFVAKDQLTGSEKYKCDKCKRKVDATKQFTIETAPPALTVHLKRFS
PFGGKISRQVAFDEKLNIAPYLSVNHGPVRYKLYAVVHHYGSGPNSGHYVASVRSPFGKW
TRMDDSHVSEMGSSGPLGDQSAYILFYLKEKDDALEKAIAAVTPVKSGNKRKAVQESEVG
SDSEEDDGAAIATAAVAALPPTKVPRSASNPANEDVSDSETSSSPPNQLNGTSEKLDLML
SSRPTSAASFYGSAASFRVSSNPFTVRSAAASGLDEELGTAVDRDEYESLVGSSTSDVIA
ASASAARRRTNAEADSESEEDSFAALSKKEKRKHKKAAQVIHAAKHSRGIPASPYASALT
SLSSLSAKEQKKKKSKRDRDRQKPMGGFAGRMKPKY
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtggtgagacggccatcgtcgcaagccgacagcggctcaggctcgcgctcc
tacagtcaatcaccacagaagaagaatggtctacatcgttccgattcgttatctagccca
accaagaaagcatcgatatccaacggccaacccaaaaagtcatcctctgtcagctcgctt
ccatcctcgccctcgaaggaagagaggaagaagttggccaaagagattcttgcctctggc
ggtgaccagcttcggcacacgctcaagcagaggggaatgctacatgccctcctctcagag
ccggtcaagtttattaaatcgaaccagaagcagggtcaggattataccacgctagggttg
acccccgtcaatgaccctgattttgcagctgtacagaaacgcaagcaagaacagaagcaa
catgcgcttttgctgcacacagactcgcccaaaatcaatggtaatacccatacctcagac
tcggacctgtccgtagaagcacagtcatcgccgtccaagagcggcaaggctaggtctcgc
gatctgtacccgtacaagctatcccttcgttttccgggtaaagtgcgtggcgtagctacg
ggtctctccaactacggcaacacttgttacatgaacagtgtcatgcaatctctcatccat
acaccaccgctcgcgtttgcactcctcacacaggaccttgatgcactgcatggagaattg
ggaggcaaaccaaacgttgcctttgacgctgtcgcagcgatgcaaacatttgccaagggt
tccttgatgggttcaaagccgacaaacgctcccagagacttcaaccgaaacctcaaagca
tttgcaaggccgctccgtcaaggaaggcaagaggatgcacatgaataccttcgcttcctg
ctcgaagcgctccagcagggctgcctctcacgtgcctccaagtcacttaaacccgacgac
cccattcgtgccacgtcctttgtgcaaaagatctttggcggcaagctgcgcagccgtgtg
acgtgccacaagtgcggccacaactcggacacctttgacccatttatggatctgagtctg
gatgtacgcaagggtatcaactcgctcactgacgctttccgtgcctttgttgccaaggat
cagctgacaggctccgagaagtacaagtgtgacaagtgcaagcgcaaagtcgacgctacc
aagcaattcaccatcgagacagccccaccagcgctcacggtgcatcttaagcgcttttct
cctttcggcggaaaaatctcgcgtcaggttgcctttgacgaaaagctcaacatcgctcct
tacttgtcggtcaatcacggtcctgtgaggtacaaactttacgctgtcgtgcaccactac
ggatcagggccgaacagcggtcattatgtggctagcgttaggtctcctttcggaaagtgg
acaaggatggacgacagtcacgtctccgagatgggcagcagtggaccacttggcgaccaa
agcgcctatattcttttctatctcaaagagaaggacgacgcgctggagaaggccattgcg
gcagtaactccagtcaagtctggaaacaagcgcaaagctgtgcaggagtccgaggttgga
tccgattctgaagaggacgatggcgctgctattgctactgctgctgtcgctgctctcccg
ccaaccaaggtgccaaggagtgcgtccaaccccgccaacgaggatgtcagtgactcggaa
acgtcctcatctccaccgaatcaattgaacggaacgagcgagaagcttgatctgatgctt
tcatctagacctacatcagcagccagcttttacggtagcgctgcttctttccgagtatca
tctaatcccttcaccgtgcgctctgccgcagcttctgggctagatgaagagcttgggaca
gcagtcgacagagacgagtacgagtctcttgttggttccagcacttccgatgtcatcgcg
gcatctgcgagcgcagcgcgtcgtcgaacaaatgcagaggcagactcagaatcagaagaa
gactcgtttgccgctctgtccaaaaaagaaaaacgcaagcacaaaaaagcggcgcaagtg
atccatgctgccaaacactcgcgaggcattcctgcctcaccttacgctagcgcattgacc
tcgctaagctctctttcggctaaggagcagaagaagaagaagagtaagagggacagagat
aggcagaagccgatgggtgggtttgctggtcggatgaagccgaaatactag

DBGET integrated database retrieval system