KEGG   Ustilago maydis: UM01276.1Help
Entry
UM01276.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
uma  Ustilago maydis
Brite
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     UM01276.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 386 aa AA seqDB search
MWVDEAKRVRGVAFERRELLKTRWSKRSTALLSGVAQPLGRVRAITSNAIVNQVKRFSVP
EFTIGQNHEYEAPNTHDEFRIRDLIVDSTGNFYRPNRYTLRKSHTRDSRLTTRDWDYENR
EPFTIHDSRLFMISLTSRTHRHTRARIVAEFKRASWRQSQKVLDAGFDRLDSCPRTWLAH
QATPLYTLSQTHLVLRCTLHPPNRGCQNVANMGQQGSQLLSDIEATSNFNSKEIQRLKKR
FMKLDRDGSGSIDKDEFLQIPQIANNPLALRLIAIFDEDGGGTVDFQEFVAGLSAFSNQG
SREEKLKFAFKVYDMDRDGLISNGELFLVLKMMVGNNLKDQQLQQIVDKTIMEADTNGDG
KLDFDEFQAMVANTDVAKQLTLEDLF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttgacgaagccaagagggtgagaggtgttgctttcgaacgccgcgagctacta
aaaactcgttggtctaagcggtccacagcgttgctaagtggagttgcgcaacccctcggc
cgcgtacgcgcgatcaccagcaacgcaatcgtgaatcaagtaaagcgcttttcagtgcca
gaattcacgattggacagaatcatgaatacgaagcaccgaacacgcacgacgaattcagg
attcgtgatttaatcgtggattcaacaggaaacttttaccggcctaacagatataccctc
cgaaaaagtcatacccgtgactcacgactcacgactcgtgactgggactacgagaaccgt
gaaccattcacgattcacgattcaagattattcatgatttcactcacgagtcgcacacac
agacacacacgcgcgcgcatcgtcgccgagtttaaacgagcttcctggcggcaaagtcaa
aaagtgttggacgctggcttcgatcgacttgactcttgtccaagaacttggctcgcgcat
caagcaactcccttatacaccctttcccagacccaccttgtgctgcgttgcactttgcac
cccccgaatcgcggctgccaaaacgtcgcaaacatgggtcaacaaggctcccagctgctg
tcggacatcgaagcaacgtcgaacttcaactcgaaggagatccaacgtctgaagaaacgg
tttatgaaactggaccgtgatggatctggctcgatcgacaaagacgaattcctgcagatt
ccgcagatcgccaacaacccactagcgcttcgactgatcgcaatctttgatgaggacgga
ggaggcacggtcgattttcaagagttcgttgctggtctctctgcgttttctaaccaaggc
tctcgcgaagaaaagctcaagttcgcattcaaggtgtacgatatggaccgagacgggctg
atcagcaacggcgaattgttcttggtactcaagatgatggtcggcaacaacttgaaggat
caacagttgcaacagattgtggataagaccatcatggaagcggacaccaacggagatggt
aaattggactttgacgagttccaggctatggtcgctaataccgacgtggcgaaacagttg
acattggaagatctgttctag

DBGET integrated database retrieval system