KEGG   Ustilago maydis: UM01352.1Help
Entry
UM01352.1         CDS       T01021                                 

Definition
similar to histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UM01352.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 559 aa AA seqDB search
MTSATLATPHRMRMTHNLVTNYGLHKKMDILRPKRATRDQMTRFHTDEYVDFLHRVTPET
VHELTNEGTRYLIGEDCPAFDGLYEFCSISAGGSLAAATRLNSGESDVAINWAGGLHHAK
KREASGFCYVNDIVLAILELLRVHLRVLYIDIDIHHGDGVEEAFYTTDRVMTASFHKFGD
FFPGTGDVRDIGMKKGKNYCVNVPLRDGIGDLEFGNIFRPIISHIMEWYRPGAVVLQCGA
DSLAGDKLGCFNLSMRGHAECVAFMQTFDVPLITLGGGGYTVRNVARTWTYETGLLVGQK
LDEDLPFNDYIQYFGPEYKLEVPPTSMDNLNSREYLDNLRTKIIDNLRNLPSAPGVQMQE
TPRTTLNPADVEMSDGEDSDLDERISQHLRDAHVQHWDDELSGDEAQVDGERLESVWAMA
TDRSSGASNGRSRPGIMDPLKPYEHDLGLKYISHNGVAAAKGKPRAKRTFFAARAAKPGL
ADLHLDDDDEQDDDEQRHHIASQFGGRRTRAFFAANQGSTRLPRDATPLSDVDIGSPALS
AAAVASTNGQARSAVNGRR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggcaactttagctacgccgcatcgtatgcgcatgacgcacaatctcgtcacc
aactatggtctgcacaaaaagatggacatcctccgtcccaagcgagccactcgcgaccag
atgacgcgcttccacactgatgagtacgtcgactttcttcaccgcgtcacgcctgaaacc
gttcacgagctcaccaacgaaggtactcgctacctcatcggcgaagattgccctgctttt
gacggtctgtacgagttctgttcgatctcagccggcggatcgcttgctgctgctactcgt
ctcaattcaggcgaatcggatgtggctatcaattgggcaggcggtctgcatcacgccaag
aagagagaggcgagtggtttctgctacgtcaacgacatcgtccttgccatcctcgagctg
ctccgagtccacctgcgcgtcctctacatcgacattgacatccaccacggggacggcgtc
gaagaggccttctacaccaccgaccgtgtcatgactgccagcttccacaaattcggcgac
ttcttccccggtaccggtgacgtccgcgatatcgggatgaagaaaggcaaaaactactgc
gtcaacgttccgctccgcgacggtattggcgatctcgagttcgggaacatcttccgtccc
atcatctctcacattatggaatggtatcgtcccggtgccgtggttctgcagtgcggcgct
gattcgctggcgggcgacaagctgggctgcttcaatctttccatgcgcggacatgccgag
tgcgtcgcgttcatgcagaccttcgatgtgccacttatcacgcttggtggaggaggatat
acggtgcgcaacgtcgcacgcacatggacctacgagacgggtctgctcgttggtcagaag
ctcgacgaagacctgcccttcaacgactatatccagtactttggccccgaatacaagctc
gaggtgccacccacatcgatggacaacctcaactcgcgcgagtatctcgacaatcttcgc
accaagatcatcgacaacttgcgcaaccttccgtcggcgcccggcgtgcagatgcaggag
acgccgcgcaccacgctcaatcccgcggatgtcgagatgtcggatggcgaggattcggat
ctggacgagcggatttcgcagcatctacgcgacgcacatgtgcagcattgggatgacgag
ctgtctggcgacgaagctcaggtggatggtgagcgtttggaatccgtttgggccatggcg
acggatagaagcagtggcgcatcgaatggcaggagtcgaccgggcatcatggatccattg
aagccttacgagcacgatttgggtctcaagtacatctcgcacaatggcgtagcagcagcc
aaaggtaagccaagagcgaaacgcacattcttcgctgcacgagctgccaaacctggcctc
gccgatctgcatctagacgatgacgacgagcaagacgacgacgagcaacgtcaccacatt
gcgagtcagttcgggggcaggcgtaccagggcgtttttcgcagcgaatcaaggcagcacg
cgtttgccacgcgatgctacgcccttgagtgacgttgacattggctcgcctgctttgtcc
gctgccgccgtcgcttccaccaacggtcaagctcgaagtgctgtcaacggtcgcaggtag

DBGET integrated database retrieval system