KEGG   Ustilago maydis: UM01505.1Help
Entry
UM01505.1         CDS       T01021                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
uma  Ustilago maydis
Brite
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UM01505.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 142 aa AA seqDB search
MPPKPAEKKPSSTAGKAPASSAGKAPAEAAKKTSKAPAKSGEKKKATKVRKETYSTYIYR
VLKQVHPDTGISNKAMAILNSFVQDIFERIATEASKLASYNKKSTISSREIQTAVRLILP
GELSKHAISEGTKSVTKFSSSK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaagcccgccgagaagaagccctcctccaccgccggcaaggcgcctgcctcg
tccgctggcaaggcccctgctgaggccgccaagaagacctcgaaggcccccgccaagtct
ggcgaaaagaagaaggccaccaaggttcgcaaggagacctactcgacctacatctaccgt
gtgctcaagcaggttcaccctgacactggtatctcgaacaaggccatggccattcttaac
tcgttcgtccaggacatctttgagcgcatcgcaactgaggcgtcgaagctcgcttcgtac
aacaagaagtcgaccatctcgtcgcgagagatccagacggctgtccgcctcattcttccc
ggtgagctttccaagcacgccatctcggaaggtaccaagtcggtcaccaagttctcttcg
tccaagtaa

DBGET integrated database retrieval system