KEGG   Ustilago maydis: UM01514.1Help
Entry
UM01514.1         CDS       T01021                                 

Definition
protein kinase Fuz7
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 435 aa AA seqDB search
MLSSGAGSSIRKKRNFKGLQLAESPLASPVDASATTPSHKPGEGSAASNASTIGKSSAVT
PGGSLALPVKNGLDTEPNSGANYHNKLTQQLANLELGVEYKLDLKNEDLKTLSELGAGNG
GTVTKVLHEKSGTVMAKKVVFIDAKPSVRKQILRELQILHECNSPYIVSFYGAYLNEPHI
CMCMEFMQKDSLDGIYKKYGPISPEICGKIAVAVSHGLTYLYDVHRIIHRDVKPSNILVN
GAGQIKICDFGVSGELINSIADTFVGTSTYMSPERIQGDQYSVKSDVWSLGVSIIELALG
RFPFAENEEDDDSDADNNYTNEDLAGTLSPTKPAPMISLGQNEKQRRRKSKPAGVSLEGS
SHQMSILDLLQHIVNEPPPKLPEGRFPKHMEEFVNLCLLKDPAKRPTPKDLTKHQYVIDA
DAAKVDLQAWADGMK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgtccggtgcgggatcttccatacgcaagaagcgcaacttcaaggggctacaa
ctggccgagtcacctctcgccagtcccgtcgacgcttcggctacaacaccatcacacaaa
ccaggcgaaggctccgccgcctcaaatgcatccaccatcggcaaatcctctgcagtgacg
ccgggcggctcccttgcactcccggtcaagaatggtctggatacagaacccaactcggga
gccaattaccacaacaagttgacgcagcaactggccaacctcgaactgggcgtcgaatac
aagcttgacttgaagaacgaggacctcaagacgctctcggagctcggcgccggtaatggc
ggaactgtcaccaaggtgctgcacgagaagagcggaaccgtgatggccaaaaaggtggtc
ttcatcgacgccaaacctagcgtacgcaagcagatcctacgagagcttcagatcctgcac
gagtgcaattcgccctacattgtctcgttctacggcgcctatctcaacgaaccgcacatc
tgcatgtgcatggagtttatgcagaaggattcgctcgatggcatctacaaaaagtacggg
ccaatctcaccggaaatttgtggcaagattgccgtggcagtctcgcacggcctcacctac
ctctacgacgtgcatcgaatcatccaccgtgacgtcaagcctagcaacattctagtcaac
ggtgccggtcaaatcaaaatctgtgactttggcgtaagcggagagctcatcaacagcatt
gcagacacgtttgttggtacaagtacctacatgtcgcctgagcgaattcagggagatcag
tacagtgtcaagtcggatgtatggagcttgggcgtgtcgatcatcgagctggcgctgggt
cgcttcccttttgcagagaacgaagaggacgacgactcggacgcggataacaactatacg
aacgaagatctggcggggacactttcaccgaccaaaccggcaccaatgatttcgctcggc
caaaacgaaaaacagagacgcagaaaatcaaaaccggccggcgtaagcctcgagggctcg
agccatcagatgtcaattctcgacctgctgcaacacattgtcaacgaaccacctcccaag
ctgccagagggcagatttcccaagcacatggaagagtttgtcaacctttgtctgctcaaa
gacccggcgaaacggcccacacccaaggacctcaccaagcaccagtacgtgatcgatgcc
gatgccgccaaggtggacttgcaagcatgggccgatgggatgaagtaa

DBGET integrated database retrieval system