KEGG   Ustilago maydis: UM01514.1Help
Entry
UM01514.1         CDS       T01021                                 

Definition
(RefSeq) protein kinase Fuz7
  KO
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UM01514.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     UM01514.1
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   UM01514.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 435 aa AA seqDB search
MLSSGAGSSIRKKRNFKGLQLAESPLASPVDASATTPSHKPGEGSAASNASTIGKSSAVT
PGGSLALPVKNGLDTEPNSGANYHNKLTQQLANLELGVEYKLDLKNEDLKTLSELGAGNG
GTVTKVLHEKSGTVMAKKVVFIDAKPSVRKQILRELQILHECNSPYIVSFYGAYLNEPHI
CMCMEFMQKDSLDGIYKKYGPISPEICGKIAVAVSHGLTYLYDVHRIIHRDVKPSNILVN
GAGQIKICDFGVSGELINSIADTFVGTSTYMSPERIQGDQYSVKSDVWSLGVSIIELALG
RFPFAENEEDDDSDADNNYTNEDLAGTLSPTKPAPMISLGQNEKQRRRKSKPAGVSLEGS
SHQMSILDLLQHIVNEPPPKLPEGRFPKHMEEFVNLCLLKDPAKRPTPKDLTKHQYVIDA
DAAKVDLQAWADGMK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgtccggtgcgggatcttccatacgcaagaagcgcaacttcaaggggctacaa
ctggccgagtcacctctcgccagtcccgtcgacgcttcggctacaacaccatcacacaaa
ccaggcgaaggctccgccgcctcaaatgcatccaccatcggcaaatcctctgcagtgacg
ccgggcggctcccttgcactcccggtcaagaatggtctggatacagaacccaactcggga
gccaattaccacaacaagttgacgcagcaactggccaacctcgaactgggcgtcgaatac
aagcttgacttgaagaacgaggacctcaagacgctctcggagctcggcgccggtaatggc
ggaactgtcaccaaggtgctgcacgagaagagcggaaccgtgatggccaaaaaggtggtc
ttcatcgacgccaaacctagcgtacgcaagcagatcctacgagagcttcagatcctgcac
gagtgcaattcgccctacattgtctcgttctacggcgcctatctcaacgaaccgcacatc
tgcatgtgcatggagtttatgcagaaggattcgctcgatggcatctacaaaaagtacggg
ccaatctcaccggaaatttgtggcaagattgccgtggcagtctcgcacggcctcacctac
ctctacgacgtgcatcgaatcatccaccgtgacgtcaagcctagcaacattctagtcaac
ggtgccggtcaaatcaaaatctgtgactttggcgtaagcggagagctcatcaacagcatt
gcagacacgtttgttggtacaagtacctacatgtcgcctgagcgaattcagggagatcag
tacagtgtcaagtcggatgtatggagcttgggcgtgtcgatcatcgagctggcgctgggt
cgcttcccttttgcagagaacgaagaggacgacgactcggacgcggataacaactatacg
aacgaagatctggcggggacactttcaccgaccaaaccggcaccaatgatttcgctcggc
caaaacgaaaaacagagacgcagaaaatcaaaaccggccggcgtaagcctcgagggctcg
agccatcagatgtcaattctcgacctgctgcaacacattgtcaacgaaccacctcccaag
ctgccagagggcagatttcccaagcacatggaagagtttgtcaacctttgtctgctcaaa
gacccggcgaaacggcccacacccaaggacctcaccaagcaccagtacgtgatcgatgcc
gatgccgccaaggtggacttgcaagcatgggccgatgggatgaagtaa

DBGET integrated database retrieval system