KEGG   Ustilago maydis: UM01517.1Help
Entry
UM01517.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
uma  Ustilago maydis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM01517.1
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UM01517.1
  Amino acid metabolism
   00310 Lysine degradation
    UM01517.1
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UM01517.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 616 aa AA seqDB search
MTRAESSVADRGRRESHIQRANWNGQLTRFLRSVRDGETQSILLALWPFTHNHECDPALS
RDRTEDRQDRNDSRESHRLDQLAAFVLFRFSTSSTNPKLVILFFSFIVVVIESTSTSYNH
VSALEGLASLQSTEATERLAVVVIAMLSRSIAQSGARAARSLALRSGSVRMVTPAVARRT
LLTLSAQRSLALGAQNTLLSAQRGFSSSSSRKEIVKVPQMAESITEGTLKQWNKKVGDFV
KADEEVATIETDKIDVSVNAPQSGTIVEVFASEEDTVEVGKDLFKLEPGEAPAEGASSGD
KQPEKKEEKKDEDNKKDESKEQKQPEKKSDDKKPAPSADPQSRPSAASSSPPASKTTSSS
ASSSSSSPASASSSASKGGLGSREENRVKMSRMRLRIAERLKQSQNTAASLTTFNEIDMS
NLMAFRARHKDRILKEKGVKLGFMSAFAKASALALKDVPAANASIEGAGLGDTIVYRDFV
DLSVAVSTDKGLVTPVVRNLESMSLIEIEQAIAELGKKARDNKLTLEDMSGGTFTISNGG
VFGSLFGTPILNLPGSAILGMHAVKDKAWVVNGKVEIRPIMVVALTYDHRLLDGREAVTF
LVKLKQYIEDMPSMLL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagcggaaagttccgtcgccgaccgcggccgtagagagtcgcacattcaacga
gcaaactggaatggtcaactgactcgctttcttcgctcggtgcgagacggagaaactcag
tcaattcttctcgccctttggccctttacccacaatcacgaatgcgacccggctttgagt
cgtgaccgcacagaggaccgacaggacagaaacgacagtcgtgagtcgcaccgacttgat
cagctagctgctttcgttctttttcgtttctccacaagctctaccaatccgaagctcgtc
attcttttcttctccttcatcgtcgtcgtcatcgagtcaacatcgacatcatacaatcac
gtgtctgcgctggaaggacttgcctcacttcaatccaccgaggctactgaaagactagcc
gtcgtcgttatcgcaatgctctcacgatccatcgctcaatctggcgctcgcgctgctagg
agtcttgcgctccgaagcggctcggtccgcatggtcacacctgctgtcgctcgacgaaca
ctgctcactttgtctgctcagaggtcgctcgcattgggtgctcagaacacccttctttct
gctcagaggggcttctcgtcttcctcgagccgcaaggagatcgtcaaggttccccagatg
gctgagtccatcaccgagggtaccttgaagcagtggaacaagaaggttggcgactttgtc
aaggccgatgaggaggttgctactatcgagaccgacaagatcgatgtctctgtcaacgct
cctcaatccggtaccattgtcgaggtgttcgccagcgaagaggacacggttgaggtcggc
aaggacctgttcaagctcgagccgggcgaggctcccgccgagggcgctagttctggcgac
aagcagcccgaaaagaaggaggagaagaaggatgaggacaacaagaaggacgagtccaag
gagcagaagcagcccgagaagaagagcgacgacaagaagcctgctccgtcggctgatccg
caatcgcgaccttcggcggccagctcgtcgcctcctgcatccaagacgacatcttcgtca
gcttcgtcttcgtcatcttcgccggcttcggcttcttcttcggcatcaaaaggcggtctt
gggagccgagaggagaatcgcgtcaagatgtcgcgaatgcgtctgcgtatcgctgagcgc
ttgaagcagtcgcagaacacagcggcttcgctcaccacgtttaacgagattgacatgtcg
aacctcatggccttccgtgcacgacacaaggaccgcatcctcaaggagaagggtgtcaag
ctcggcttcatgtcggccttcgccaaggcttcagcgttggcgctcaaagacgttccggct
gccaacgccagcattgagggagccggtctgggtgacacgattgtctaccgcgactttgtg
gacctctcggttgctgtttcgacggacaagggacttgtgacgcctgttgtaaggaacctg
gagagcatgtcgctcatcgagatcgagcaggcgatcgctgagctcggcaagaaggcgcgt
gacaacaagctgacactcgaagacatgagcggcggcacgttcaccatcagcaacggcggt
gtgtttggctcgctgtttggtacgccgatcctcaatctacccggttcggccatcttgggc
atgcacgccgtcaaggacaaggcatgggttgtcaacggcaaggttgagatccgaccgatc
atggtggtagctttgacttacgaccaccgactgcttgacggtcgtgaagcggtaaccttc
ctggtcaagctcaagcagtacattgaggacatgcccagcatgcttctctaa

DBGET integrated database retrieval system