KEGG   Ustilago maydis: UM01664.1Help
Entry
UM01664.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
uma  Ustilago maydis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    UM01664.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     UM01664.1
Transfer RNA biogenesis [BR:uma03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    UM01664.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 381 aa AA seqDB search
MSLSSSSTRNAFALERAVAISAVERACSLTDKVFRNLVTADTVTKKDKSPVTVGDYSAQA
VVNAILGSYFPEDPIVGEEDSKDLQKPESEALRKQIFDLANQALKTGSEEWAAVAEAESK
TNTPAWRERELTEQELLAAIDRGSAEGGAKGRCWALDPIDGTKGFLRGGQYAVCLGFMVD
GVVQVGVMGCPNLPHDASSAKPKEGEFGAGEKRSDLGTLFIAVRGQGAFQRPIQGGKEEK
ISMRQISSLSAASFCESVEAGHSSHGTNARIAELLGITAASVRMDSQAKYASISRGDGDV
YLRLPVGDGSYQEKIWDHAAGSLLVQEAGGKVSDIRGKDLNFGVGRTLRENRGVVASSQE
HHAKVIDAVRKALEEEGRGHL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcgtcttcatcaacacggaacgccttcgcgttggagcgagcggtggcaatc
tcggcggtggaacgcgcatgctcgctcacggataaagtcttccgcaaccttgtcaccgcc
gacacggtcacgaaaaaggacaagtcgcctgtcacggtcggcgactactcggcgcaagca
gtcgtcaatgcgattctcggatcgtatttccccgaggaccccatcgttggagaggaggat
tccaaggatcttcagaagcccgagtccgaggcgctgcgtaagcaaatctttgatctggcc
aatcaagcgctcaaaaccggctcggaagaatgggctgcagtagccgaggcagagtcaaaa
accaacacgccagcatggcgtgagcgcgagttgaccgagcaggagcttctggcagccatc
gaccggggcagcgcagagggtggtgccaaaggccgatgctgggcactcgaccccatcgac
ggcaccaaaggtttcttgcgtggcgggcagtacgcggtgtgcctcggttttatggtcgac
ggtgtcgtccaagtcggcgtgatgggatgccccaacctgccgcacgacgcttcttctgcc
aaacctaaggaaggcgaatttggtgcaggcgaaaagagaagcgatctcggcactttgttc
attgccgttcgaggacagggtgctttccaacgtccgattcaaggtggcaaggaagaaaaa
atctcgatgcgacagatcagctcgctctcggccgcttcgttctgtgagtcggtcgaggca
ggccactcttcgcatggcaccaacgccagaatcgcagagctactcggcatcacggctgcc
tcggtgaggatggatagccaggccaagtacgccagcatttccagaggagatggcgacgtc
tacttgcggctgcccgtcggcgatggcagttaccaggaaaagatctgggaccacgctgcc
ggatctctgctcgttcaagaggcggggggtaaggtctcggacattcgcggcaaggacctc
aactttggcgtcggacgaacgctgcgcgaaaaccgcggtgtggtcgcatcgagccaagag
caccacgcaaaggtgattgatgcagtgcgcaaggctctcgaagaggagggccgcggtcat
ctctga

DBGET integrated database retrieval system