KEGG   Ustilago maydis: UM01772.1Help
Entry
UM01772.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM01772.1
   00052 Galactose metabolism
    UM01772.1
Enzymes [BR:uma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     UM01772.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 462 aa AA seqDB search
MTCKTFILPLALQLLASSAALSSPTFMIQPTGVERNDASRSAATAASKETPGFVNNGTIG
SYSCLYTSQLEDSQLILGAASTAPGSQCPEALPPVYPHNRIELRAPDDSIRATFQPYGST
VTELWVKDRWGGWRDIVLGYDNTTNWSTDPIHPNFGPIVGRYANRIKNGTFELNGHTFHV
PKNENGLDSLHGGDIGYDRSNYTIAKLSANEVVMEHTDPAGFQGFPGKVKTTTRYQLGEN
ATWHIEINATATQETPILLSSHVYWNLDAFNETASVLDYVLHMPYADKYVKTDTILIPTG
PLPSVENTPFDFQTPTSFSKNFNQTNGVCGYSCQGWDSCFVMSKPPGYDQLKPALEMYSK
RSGIRLSVVTNQASVQVYTCDGINSPAKGSIPRKQVHGGKVGNDIGAVIYDNHECVVLEL
EDYIDGINNPQWGRNQIYGPHRPYHWKSTYTFSNVDEDGKPM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcaaaacatttatcttaccgctggcattacagcttctcgcctcttcggccgcg
ctatcgagcccaacgtttatgatccagcctacaggggtcgaacgcaacgatgcaagtcgt
agtgcagccacagctgcttcaaaagaaactcctggattcgtcaacaatggcacgatcggc
agctactcttgtctgtacacctcgcagttggaggattcacaattgattctcggggcagcg
tctacggctccaggctcgcagtgccccgaagctctaccgccggtatacccacacaaccgc
atcgagctgcgtgcaccggacgattcgattcgcgccaccttccagccatacggctcaacc
gtcaccgagctctgggtcaaagaccgttggggtggatggagagatatagtgctcggctac
gacaacacgaccaactggtccacggatcccattcaccccaattttggcccaatcgtcggt
cgttacgccaatcgaatcaagaatggcacgtttgaactcaatggtcacacctttcacgtt
ccgaagaacgagaatggtcttgactcgcttcacggtggtgacattggttacgatcgaagc
aactataccattgccaaactgagcgccaatgaggtggtgatggaacacactgatcctgct
ggtttccagggtttccccggtaaagtcaagacgacaacgcgctaccagctaggcgagaat
gctacgtggcacatcgagatcaacgctacagcaacacaggaaacgccgattcttctttcg
tctcatgtgtactggaatttggacgcgttcaatgagacggcctcagtattggactatgtc
ctgcacatgccgtacgcggataagtacgtcaaaacggacaccattctgatcccaactggt
cccttgccatcggtcgagaacacaccgttcgatttccaaacgcccacttcattctcgaag
aatttcaatcagacaaacggcgtatgtggatacagctgtcagggttgggattcgtgtttc
gtcatgtccaagcctcccggatacgatcagctcaaaccggcgttggagatgtacagcaag
cgatcgggtatcaggctttcggtggtgacaaaccaggcctctgtacaagtgtacacgtgt
gatggaatcaatagtcccgcaaagggaagcattccgaggaagcaggtccatggcggtaaa
gttggcaatgatattggtgcagtgatctacgacaaccacgagtgcgtcgtgttggagttg
gaagattacatcgatggtataaacaacccgcagtggggcaggaaccagatctatggtccg
cacaggccctatcactggaagtcgacgtacacgttttcaaacgtagatgaagatggcaag
ccaatgtga

DBGET integrated database retrieval system