KEGG   Ustilago maydis: UM01784.1Help
Entry
UM01784.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
uma  Ustilago maydis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:uma00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:uma00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 161 aa AA seqDB search
MVSFYDLKAKKPSQEDYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYADQGLQII
GFPCNQFAGQDPGSDESIGEFCQRNYGVTFPMMAKSDVNGSNTNEVFQFLKKEKAGILGT
EMIKWNFTKFLIDKEGNVIERYGSNTKPSAIAPAIEKLLSQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggtctcattctacgatctcaaggccaaaaagcccagccaggaggactacacctttgat
caactcaaaggcaaagtcgttctagttgtcaacaccgcctccaagtgcggatatactccc
cagtttgctgagcttgaggagctcaacaaaaagtacgctgaccagggtctgcagatcatt
gggttcccttgcaaccagtttgctggtcaagatccagggagcgatgaatccatcggcgag
ttctgccaacgtaactacggtgtaactttcccgatgatggccaaatccgatgtcaacggc
agtaacaccaacgaggtcttccagttcctcaagaaggaaaaggctggcattcttggtacc
gagatgatcaagtggaacttcaccaaattccttatcgacaaggagggtaacgtcattgag
cgatatggatccaacaccaaaccatcggccatcgcacccgccatcgagaagcttctctcc
cagtga

DBGET integrated database retrieval system