KEGG   Ustilago maydis: UM01784.1Help
Entry
UM01784.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
uma  Ustilago maydis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    UM01784.1
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UM01784.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UM01784.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 161 aa AA seqDB search
MVSFYDLKAKKPSQEDYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYADQGLQII
GFPCNQFAGQDPGSDESIGEFCQRNYGVTFPMMAKSDVNGSNTNEVFQFLKKEKAGILGT
EMIKWNFTKFLIDKEGNVIERYGSNTKPSAIAPAIEKLLSQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggtctcattctacgatctcaaggccaaaaagcccagccaggaggactacacctttgat
caactcaaaggcaaagtcgttctagttgtcaacaccgcctccaagtgcggatatactccc
cagtttgctgagcttgaggagctcaacaaaaagtacgctgaccagggtctgcagatcatt
gggttcccttgcaaccagtttgctggtcaagatccagggagcgatgaatccatcggcgag
ttctgccaacgtaactacggtgtaactttcccgatgatggccaaatccgatgtcaacggc
agtaacaccaacgaggtcttccagttcctcaagaaggaaaaggctggcattcttggtacc
gagatgatcaagtggaacttcaccaaattccttatcgacaaggagggtaacgtcattgag
cgatatggatccaacaccaaaccatcggccatcgcacccgccatcgagaagcttctctcc
cagtga

DBGET integrated database retrieval system