KEGG   Ustilago maydis: UM01858.1Help
Entry
UM01858.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
uma  Ustilago maydis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UM01858.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     UM01858.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 461 aa AA seqDB search
MITRKNALILAFVLACASLASSHASPHSPGLDQEHHGAGAHSSAEYAPIPLVEFPSNDID
DPWTKKYSGVAKPAYSGVNTYAHLPTVKCLDDPSQLFDVAVLGIPYDLTVTYRPGARFGP
NAIRQASRRQRAGRTYSLYHAQDPYNTGLRFLDCDDIPTSGFDPALAIDQIEAGYTSLLQ
RRAASDPSLSFSSTPPNSVVSTKSWQAFSNAGLAKDGRSHPKIVSMGGDHTIVLPILRSL
YRVYGPIAVIHFDAHLDTWPPEVSPAGSPTRQHQIQHGTFFWQAALEGLIARNQSIHAGI
RTRLGSYDDIQHDASIGFDIITSDDIDDLGIPAIIQNIRSRVGAMPVYLSIDIDTLDPGF
APGTGTLESAGWSPRELRRILRGLEGLNFVGFDLVEVSPAYDQAEITAYAASDLIYEFMN
LLISGNNLQADGKVAEPKRKGRRAQKAKGVVASLFNHGDEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgattaccagaaagaacgctttgatcctggcctttgtcctggcttgtgcatccttagcc
agttcgcatgcaagcccgcattctcccggactcgaccaagagcatcacggtgcaggagcg
cacagctctgccgaatacgcgcccatccctctggttgagttcccctccaacgatatcgac
gatccttggacgaaaaagtattccggcgtcgcaaagcctgcttactctggcgtgaacact
tacgcccacttgcctactgtcaagtgccttgatgatcccagccagttgttcgacgtagcc
gtgctcgggatcccttacgacctcaccgtaacctatcgacccggtgccagattcgggccg
aatgcgattcgtcaagctagcagacggcagagagcgggcagaacgtactctttgtatcat
gctcaagacccgtacaataccggtttgcgatttctagactgtgacgacattcccacttct
ggatttgatcctgctttggcgatcgatcagatcgaagctgggtatacttcgcttttgcaa
cgtcgagctgcttccgatccatcgcttagcttctcttcaactccaccaaactcagtagtt
tcgaccaaatcgtggcaagcattctccaacgcaggcttggcaaaagacggcagatcgcac
cccaagatcgtctccatgggtggagatcacacgattgtgctgccgatccttcgatcgctc
taccgagtatatggacccatcgcggtgattcactttgatgcacatctcgacacatggcct
ccagaggtctcacctgcaggctcgccaacgcgccaacaccagatccagcacggcaccttt
ttctggcaagctgcgctcgaaggacttatcgcacgcaatcaatccattcacgccggcatc
cgtacacgactcggctcctacgacgacattcaacacgacgcatcgatcggcttcgacatc
atcacctccgatgacattgacgaccttggcattccggctatcatccaaaacatccggtct
cgtgttggcgccatgcccgtctatctcagtatcgatattgatacgctcgatccgggcttt
gctccgggcacaggcacgttggaatccgcaggttggagccccagagagctgaggaggatt
ttgagaggactggaagggctgaactttgtcggatttgatttggtagaagtgagcccagcg
tatgaccaggccgagatcacagcgtatgcagcaagcgatttgatctacgaattcatgaat
ctcttgattagcggcaacaacttgcaagcggatggaaaggttgctgagcccaagaggaaa
ggtaggcgggcacagaaagcaaaaggcgtcgttgcatctctcttcaatcatggggacgaa
ctgtaa

DBGET integrated database retrieval system