KEGG   Ustilago maydis: UM01905.1Help
Entry
UM01905.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UM01905.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   UM01905.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 240 aa AA seqDB search
MTESRMKWVPLESNPELFSSWCSSMGLDTSKYAFHDIYGTDAELLAMVPQPVAAVLLLFP
ITPSMEQLRQAENATAQPSPSDSDILWFKQTIGNACGTIGLLHALANSSASTAIKPGSPL
DTLFEKARATQDAHERADILVNSKELQTVHEATASQGQSQAPEDLDNVILHFVCFVRSKN
GELVELDGSGGRKGPINRGKKVASQQDLLPVAVDYVKDNYMALNPEEVNFNLIALAPSFD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcaagaatgaagtgggtgcctctcgagtcgaacccagagctgtttagcagc
tggtgttcatcgatgggactggatacctccaagtacgcgttccacgacatctacggaacc
gacgctgagcttcttgctatggtgcctcaacctgttgctgctgtactgctactctttccg
atcacgccttcgatggaacagcttcgccaggccgagaatgcgacggctcagccctcgcct
tccgactctgacattctgtggttcaagcagacgattggcaacgcctgtggcactatcggt
cttctccatgcgctggccaactcttccgcttccaccgcgatcaagcccggctcaccactc
gatacgctctttgaaaaggcaagagcaacgcaagatgcgcatgaaagagccgacattcta
gtcaactcgaaagagcttcagacggttcacgaggcaacagcgagtcaagggcagagtcag
gctcccgaggacctggacaatgtcattttgcactttgtctgctttgtaagaagcaaaaat
ggcgaattggtcgaattggacggctccggcggaaggaaaggccccatcaatagggggaag
aaggtggcttctcagcaggatttgctgccggtggcagtggattatgtcaaagacaactac
atggcactcaatccggaagaggtcaacttcaacctcatcgcattggcgccttctttcgac
tag

DBGET integrated database retrieval system