KEGG   Ustilago maydis: UM01984.1Help
Entry
UM01984.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    UM01984.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM01984.1
  Lipid metabolism
   00071 Fatty acid degradation
    UM01984.1
  Amino acid metabolism
   00350 Tyrosine metabolism
    UM01984.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UM01984.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 370 aa AA seqDB search
MAPAATSSRSHADPREQQLQVSGQNRVAIFDKQGGPVSVKEAPIQKELKRGEALVRVIYS
GVCHTDLHAMLGDWPLDNKLPLVGGHEGAGVVVALGEGADQYVKVGDRVGIKWIATSCLN
CSFCRTGAEPNCPHAQCSGFSVDGSFQKYAVSYANHLSIIPDDLPLDQAAPILCAGVTVY
KALKEAQLNPGQWVAIPGAGGGLGHLAIQYAVAAGYRVIAIDTGADKKQLCESLGAERFI
DFKTSKNLVDDIKAATPDGFGPQAAVVAASGAAAYEQALDYIRPRGVLVAVGLPGQADIK
ANVFFTVFRSVRIVGSYVGNRQDAQEALDIAAAGKVRTHFRTLGLSQLPQVYDDMQSGKI
AGRIVLDIDQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgctgctacctcgtcccgatcgcacgccgaccctcgtgagcaacagctccag
gtctcaggccagaaccgcgtcgccatctttgacaagcagggtggtcccgtctcggtcaag
gaagcacccatccagaaagagctcaagcgaggcgaggcgctcgtccgcgtcatctactct
ggtgtctgccacaccgacctgcatgccatgctcggtgactggcctttggacaacaaactt
ccgctcgtcggtggacatgaaggtgccggtgtcgtcgtcgccctcggtgaaggtgctgac
cagtacgtcaaggtcggtgaccgtgtaggtatcaagtggatcgccacttcgtgcctcaac
tgctccttctgcaggacgggtgccgaacccaactgcccacacgcgcagtgctctggtttc
agcgtcgacggttccttccaaaagtacgccgtttcgtatgccaaccacctttcgatcatc
ccggacgatcttcctctcgaccaggccgctcctattctttgtgctggtgtcacagtgtac
aaggctctcaaggaagctcagctgaatcctggtcagtgggtcgccattcccggtgctggt
ggtggactgggacacttggccatccagtacgccgtcgctgccggctaccgtgtcatcgcc
attgacacgggtgcggacaagaagcagctctgcgaatcgctgggcgctgaacgtttcatc
gactttaagacgtccaaaaaccttgttgacgatatcaaggcggccacgcctgacggattc
ggtcctcaggcggctgtggttgctgcctctggtgctgccgcttacgaacaggcgctcgac
tacattcgcccgcgtggtgtcctggtagccgtcggcttgcccggccaggccgacatcaag
gccaacgtcttcttcaccgtcttccgctcggttcgtatcgtcggctcctacgtcggtaac
cgacaggacgcccaggaggcgctcgacatcgcagctgccggcaaggtcaggactcacttc
aggacgctcggtctctcgcagctcccacaagtctacgatgacatgcagagcggtaagatc
gctggccgtatcgtgctcgacatcgaccagtaa

DBGET integrated database retrieval system