KEGG   Ustilago maydis: UM02060.1Help
Entry
UM02060.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
uma  Ustilago maydis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UM02060.1
Enzymes [BR:uma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     UM02060.1
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UM02060.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 404 aa AA seqDB search
MNSDLKYVRQMRSHQAHSILHSGYQHPVTRAWQNQGRNITKSMFMYPIFVTDDADAEVPL
ASMPGQCRWGVNKLEGFLAPLVKKGLSSVILFGVPLKTPKDAQGTLADDPNGPVMQAIKA
LRKAFPSLYIATDVCLCEYTSHGHCGILYEDGTINNQPSVERLAEVAVNYAKAGAHCVAP
SDMMDGRVRAIKKGLIDAGFGNKVTLMAYSAKFASSLYGPFRDAVDSAPSFGDRRCYQLP
PTARGLARRAIVRDASEGADVLMVKPTLPYLDIVAEARDLAPDHPLACYQVSGEFAMIHA
GAKAGVYELRRMAEESVQSMVRAGANIILSYFTPEFLEHKMADAIPTHALWGAFWPHMKA
TAHHARRHPLSWRERWDTQAWSIASLVDLMNPHLHLRSTEANRE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgatctcaagtatgtgcgccaaatgcgttcccatcaggctcactccatcttg
cactccggttaccagcatccggttacgcgtgcatggcagaaccagggacgcaacatcaca
aagtccatgttcatgtaccccatctttgtcacagacgatgcagatgcagaggtgccgctg
gcttccatgcccggacagtgccgctggggtgtcaacaagctcgaaggctttctggctccg
ctagtcaaaaagggtctttcctctgtcattcttttcggcgtgccactcaagactccaaag
gacgcgcaaggcacgctagcagacgacccaaacggaccagtgatgcaggcaatcaaagca
ctccgaaaagccttcccttcgctctacatcgccaccgatgtctgcctctgcgagtataca
tcgcacggtcactgcggcatcctttacgaagatggcaccatcaacaaccagccttcagtc
gaacgccttgccgaggtggctgtcaactatgccaaagccggtgcacactgtgttgctcct
agtgatatgatggacggtcgtgttcgcgccatcaagaaaggtttgattgatgctgggttc
ggcaacaaggtgactctgatggcgtacagtgccaagtttgcgagcagtctgtacggtccc
ttccgcgatgcggtcgactcagcaccgtcctttggcgatcgaagatgctatcagctgcca
cccactgcgcgtggcttggctcgacgtgccattgtacgagatgcttctgaaggtgcggat
gtgctcatggtcaaacctactctgccctacctggatatcgtcgccgaagcaagggatcta
gcacccgatcacccgttggcgtgctaccaggtgagcggtgagtttgccatgatccacgcc
ggcgccaaggcaggcgtgtatgagctgcgcagaatggcagaagagtcggtacaaagcatg
gtaagagccggcgcaaatatcatcttgagctacttcactccggagttccttgagcacaag
atggccgatgcaattccaacacatgctctctggggagctttctggccccacatgaaagca
acggcccatcacgcccgtcgtcacccgctctcctggcgcgagagatgggacacgcaagcg
tggagtatcgcaagcttggttgacctgatgaatccacacttacatctgagaagtaccgaa
gcaaatcgtgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system