KEGG   Ustilago maydis: UM02089.1Help
Entry
UM02089.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
uma  Ustilago maydis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    UM02089.1
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    UM02089.1
   04113 Meiosis - yeast
    UM02089.1
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UM02089.1
Ubiquitin system [BR:uma04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     UM02089.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1145 aa AA seqDB search
MPLAVTASRSRLAATKARQPTASSSASSTTTSAPGRSKSATAPQSAPIPPPPSVLELPSP
LPTLSELQATHDIQPSPHLVARRLNSLARSFLALHAETASPDPLNWELDLCSATLFSVYA
VCLDSSSAIARATLARCARLGGFNIVLPFSPSASAASATVSASKLSSQDPHDAAGAHACI
HILQQGSSATFHDAASAREYRDACHTLGRSSDALQVSDLLRDKALGKRKAMEPAHQDASL
SQPVSSKHRYQSQLQTDQAYNAASRARIQQAQTLFSQAIQLDPFNWRAWAGLCDTGYGAA
SATKHLSASTLDRLYSNLVAKVQAPYIATEASLKSSPPFSNAHVEASPMVRKVSEDGANK
KLKVSSEVPAVPPMPPLPVSAVRNGVPSKPTDKVTPPLPTTSASAVTATRLHPASRALSA
AQTNTRHLEPVSAEKDNVKAVKVVDNATRPTRTTGVRTATVTAPTTTNARQLRSTRGNTG
VSTAATTVSRSAAAPIRAGATSAAGSVSSTSSASSTSSMSSRATVSTARTAVSSRRVASG
ASAQSAARATAAKPTSASTTRTTSTTNGASVLPKRAITAATSRLATSGNQSRPGSAMSKA
SSTSAGGAGIPARTNGTLASSRTAAEAMRLKEEQHARAKLDSLTALREPIVQQLTSMAHQ
QAADSYVLALLAQLGEAYRLLRLCEGDKAAAVLMGCVQGETAVVEDGRTQVLRQNGHGSA
ASKAAASTEIDRLLDHQIKDSLLHHLLLARSYAECSQYASAEHHFGAVTKLNPFIASHMD
VYSLVLFHLSREVKLSALAQHLAMVAPNTASTHIVVGNAFSLQKEHQTALVCFQRAAAAA
PDYAYAYTLAGHEAHDLGLHDEAIAYFRSAIRCDRRHWNAWAGLGRVYLGLGEHEHAACK
SLQQAIHLNASNHLLWDLVGWTFSLLNAPAKALECYDRAIELAPRASVLTYLRRAELLLQ
HGDVDSSHRDLVCAHDLAPEEASVHILLAQSYMRLGGGSFCHIEGATAKAKASGVMILPE
KFQAEISHHLSVAVDLDPTLLRLVKSICEGYKCLPGSKLVPNELSLMDSITIDESQPSAF
AHMQRESSRLANSTAHHLVHVAPGALQPPPPDFASSLPTHNDASSWLHRANSSLDIVLHD
TDVSI
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttgcagtgacagcgtccaggtcgcgcttggcagctaccaaggctcgccaaccc
accgcatcatcctccgcctcctctactaccacttccgcacctggccgatccaagtcagca
acagcgcctcaatcagctcctattccacctccgccatcggtgctagagttgccatccccg
cttcctacgctctcagagcttcaagcaacccacgacattcaacccagcccacaccttgtt
gctcgccgacttaactcgctcgcccgctccttccttgcattgcatgccgaaacagcgtcg
cctgaccctctcaactgggagctcgatctgtgctctgctaccttgttctctgtgtacgcc
gtgtgcctagactcgtcctcagccattgcgcgtgccactttggctagatgcgctcgtctc
ggaggcttcaacattgtgctcccgttcagtccctcggctagtgcagcgtcagcgaccgtt
tctgcttccaagctcagctctcaggaccctcatgatgccgccggtgctcacgcatgcatc
cacattcttcagcaaggatcgtcagctactttccacgacgcagccagtgcccgagagtat
cgtgatgcgtgtcacacgctcggcagatcgtccgacgctcttcaggtctctgatctgctt
cgagacaaggcacttggcaagagaaaggccatggaaccagctcatcaagatgcctctttg
tctcaacctgtttcgtcaaagcaccgttaccaatcccaactacaaaccgaccaggcgtac
aatgcagccagtcgcgcacgcatccagcaagcacaaaccctattcagccaagcaatccag
cttgatcctttcaactggcgcgcatgggcaggcctttgcgataccggatacggtgccgcc
tcggctaccaagcatctcagcgcttctacactagatcgtctttactcgaatctggtcgca
aaggtgcaggccccctacatagccaccgaagcttcgctcaagtccagcccgccattctcg
aatgcacacgtcgaagcttctcccatggtccgcaaggtgtcggaagacggcgccaacaag
aagctcaaggtttcttcagaagtccctgccgtgcctccgatgcctcccttgccggtctcc
gccgtccgcaacggcgtgccgtccaaaccaaccgacaaagtgactccaccgctgccaacc
acgtcagccagcgccgtgacggctacacgcttgcatccagcatcgcgtgctctctcggcc
gcccagaccaacacacgccatctcgagcccgtatctgccgaaaaggacaatgtcaaggca
gtcaaggttgtcgacaacgctactcggcccactcgcaccacaggtgtacgcactgctaca
gtcactgctcctaccaccacaaacgcacggcagttgcggtctacccgcggcaacacgggc
gtttcgacagcggcgaccaccgtctcgcgctccgcagcagccccgatcagagcaggcgcc
acaagtgcagccggcagcgtctcttccacctcttctgcatcttccacctcatccatgtcg
tcccgcgcaaccgtctctacggcgcgtaccgctgtgtctagccgcagagttgcgtcagga
gcatctgctcaatctgcagcgcgcgccacagccgccaagcccacttctgcatcaactact
cgcaccacaagcacaaccaatggcgccagcgttctgccaaagagggccatcaccgccgcg
acgagtcgtctggctacttccggcaatcagagtcgtcccggtagcgccatgtccaaggcg
agctccacttcggctggtggtgccggtataccagcgcgcaccaacggtaccctcgcttcc
agccgtacagctgccgaggcgatgcgtctcaaagaggagcaacatgccagagccaagctc
gattcgctcaccgcgttgcgagagccgatcgtgcagcagctcacgtccatggcgcatcag
caagctgcagacagctatgtgctggctctgcttgctcagctcggcgaagcgtatcgactc
ttgcgactctgcgagggggacaaagctgcggctgtgttgatgggctgcgtacaaggtgag
actgccgtcgtcgaggatggcagaacgcaggtgctcagacagaacggccacggttcagct
gcaagcaaagcagccgcgtccaccgagatagatcgcttgctcgaccatcaaatcaaagac
agcttgctccaccacctgctcttggcccgcagttacgccgaatgctcccagtacgcctct
gccgaacatcactttggcgccgtaaccaaactgaaccctttcattgcgtcgcacatggac
gtgtattcgcttgtgctcttccacctctctcgcgaggtcaagctgtctgcattggcgcaa
caccttgccatggttgcgcctaacacggcgtctacgcacattgtcgtcggtaacgcgttt
tcattgcagaaagagcaccagacggcgcttgtgtgttttcagcgtgccgcggcggctgcg
ccagactacgcgtacgcctacacgctcgcgggtcacgaagcgcatgatttggggctgcac
gatgaagcgattgcctacttccgcagcgcgatccgttgcgatcggcgccactggaacgcg
tgggctgggttgggtcgtgtctacctaggcctcggcgagcacgaacacgctgcatgcaag
agtctgcagcaggcgatccacctgaacgcttccaaccacctcctttgggatctggtgggt
tggacgttttcattgctcaatgcaccggccaaggcgctggagtgctacgatcgggcgatc
gaactggcaccgcgggcgtcggtgttgacgtatctgcgtcgagcagagctgttgctgcaa
catggagatgtggactcgagccatcgcgatctggtctgtgcgcacgacttggcgcccgag
gaagcaagcgtgcatatcttgctcgctcagtcgtacatgcgtctcggcggaggtagcttt
tgccacatcgaaggcgctacggccaaagccaaggcgagtggcgtcatgatcttgcccgaa
aagttccaagccgaaatcagccatcacctgagcgttgcggtagatctggaccctacgctc
ttgcgtctcgtcaagagcatctgtgaaggctacaagtgtttgcctgggagcaagctggtg
cctaacgaattgtcgttgatggactcgatcacaatcgatgaaagccagccaagcgcgttt
gcgcacatgcagcgcgagtcgagcaggctcgccaactcgaccgcgcaccacctcgtgcac
gttgctccaggcgctctgcaacctccaccgccagattttgccagcagcctccccacgcac
aacgacgcaagcagctggctccaccgcgcgaattccagcctggatatcgtcctgcacgac
acagatgtttccatctga

DBGET integrated database retrieval system