KEGG   Ustilago maydis: UM02089.1Help
Entry
UM02089.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
uma  Ustilago maydis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:uma04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:uma04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:uma04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1145 aa AA seqDB search
MPLAVTASRSRLAATKARQPTASSSASSTTTSAPGRSKSATAPQSAPIPPPPSVLELPSP
LPTLSELQATHDIQPSPHLVARRLNSLARSFLALHAETASPDPLNWELDLCSATLFSVYA
VCLDSSSAIARATLARCARLGGFNIVLPFSPSASAASATVSASKLSSQDPHDAAGAHACI
HILQQGSSATFHDAASAREYRDACHTLGRSSDALQVSDLLRDKALGKRKAMEPAHQDASL
SQPVSSKHRYQSQLQTDQAYNAASRARIQQAQTLFSQAIQLDPFNWRAWAGLCDTGYGAA
SATKHLSASTLDRLYSNLVAKVQAPYIATEASLKSSPPFSNAHVEASPMVRKVSEDGANK
KLKVSSEVPAVPPMPPLPVSAVRNGVPSKPTDKVTPPLPTTSASAVTATRLHPASRALSA
AQTNTRHLEPVSAEKDNVKAVKVVDNATRPTRTTGVRTATVTAPTTTNARQLRSTRGNTG
VSTAATTVSRSAAAPIRAGATSAAGSVSSTSSASSTSSMSSRATVSTARTAVSSRRVASG
ASAQSAARATAAKPTSASTTRTTSTTNGASVLPKRAITAATSRLATSGNQSRPGSAMSKA
SSTSAGGAGIPARTNGTLASSRTAAEAMRLKEEQHARAKLDSLTALREPIVQQLTSMAHQ
QAADSYVLALLAQLGEAYRLLRLCEGDKAAAVLMGCVQGETAVVEDGRTQVLRQNGHGSA
ASKAAASTEIDRLLDHQIKDSLLHHLLLARSYAECSQYASAEHHFGAVTKLNPFIASHMD
VYSLVLFHLSREVKLSALAQHLAMVAPNTASTHIVVGNAFSLQKEHQTALVCFQRAAAAA
PDYAYAYTLAGHEAHDLGLHDEAIAYFRSAIRCDRRHWNAWAGLGRVYLGLGEHEHAACK
SLQQAIHLNASNHLLWDLVGWTFSLLNAPAKALECYDRAIELAPRASVLTYLRRAELLLQ
HGDVDSSHRDLVCAHDLAPEEASVHILLAQSYMRLGGGSFCHIEGATAKAKASGVMILPE
KFQAEISHHLSVAVDLDPTLLRLVKSICEGYKCLPGSKLVPNELSLMDSITIDESQPSAF
AHMQRESSRLANSTAHHLVHVAPGALQPPPPDFASSLPTHNDASSWLHRANSSLDIVLHD
TDVSI
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttgcagtgacagcgtccaggtcgcgcttggcagctaccaaggctcgccaaccc
accgcatcatcctccgcctcctctactaccacttccgcacctggccgatccaagtcagca
acagcgcctcaatcagctcctattccacctccgccatcggtgctagagttgccatccccg
cttcctacgctctcagagcttcaagcaacccacgacattcaacccagcccacaccttgtt
gctcgccgacttaactcgctcgcccgctccttccttgcattgcatgccgaaacagcgtcg
cctgaccctctcaactgggagctcgatctgtgctctgctaccttgttctctgtgtacgcc
gtgtgcctagactcgtcctcagccattgcgcgtgccactttggctagatgcgctcgtctc
ggaggcttcaacattgtgctcccgttcagtccctcggctagtgcagcgtcagcgaccgtt
tctgcttccaagctcagctctcaggaccctcatgatgccgccggtgctcacgcatgcatc
cacattcttcagcaaggatcgtcagctactttccacgacgcagccagtgcccgagagtat
cgtgatgcgtgtcacacgctcggcagatcgtccgacgctcttcaggtctctgatctgctt
cgagacaaggcacttggcaagagaaaggccatggaaccagctcatcaagatgcctctttg
tctcaacctgtttcgtcaaagcaccgttaccaatcccaactacaaaccgaccaggcgtac
aatgcagccagtcgcgcacgcatccagcaagcacaaaccctattcagccaagcaatccag
cttgatcctttcaactggcgcgcatgggcaggcctttgcgataccggatacggtgccgcc
tcggctaccaagcatctcagcgcttctacactagatcgtctttactcgaatctggtcgca
aaggtgcaggccccctacatagccaccgaagcttcgctcaagtccagcccgccattctcg
aatgcacacgtcgaagcttctcccatggtccgcaaggtgtcggaagacggcgccaacaag
aagctcaaggtttcttcagaagtccctgccgtgcctccgatgcctcccttgccggtctcc
gccgtccgcaacggcgtgccgtccaaaccaaccgacaaagtgactccaccgctgccaacc
acgtcagccagcgccgtgacggctacacgcttgcatccagcatcgcgtgctctctcggcc
gcccagaccaacacacgccatctcgagcccgtatctgccgaaaaggacaatgtcaaggca
gtcaaggttgtcgacaacgctactcggcccactcgcaccacaggtgtacgcactgctaca
gtcactgctcctaccaccacaaacgcacggcagttgcggtctacccgcggcaacacgggc
gtttcgacagcggcgaccaccgtctcgcgctccgcagcagccccgatcagagcaggcgcc
acaagtgcagccggcagcgtctcttccacctcttctgcatcttccacctcatccatgtcg
tcccgcgcaaccgtctctacggcgcgtaccgctgtgtctagccgcagagttgcgtcagga
gcatctgctcaatctgcagcgcgcgccacagccgccaagcccacttctgcatcaactact
cgcaccacaagcacaaccaatggcgccagcgttctgccaaagagggccatcaccgccgcg
acgagtcgtctggctacttccggcaatcagagtcgtcccggtagcgccatgtccaaggcg
agctccacttcggctggtggtgccggtataccagcgcgcaccaacggtaccctcgcttcc
agccgtacagctgccgaggcgatgcgtctcaaagaggagcaacatgccagagccaagctc
gattcgctcaccgcgttgcgagagccgatcgtgcagcagctcacgtccatggcgcatcag
caagctgcagacagctatgtgctggctctgcttgctcagctcggcgaagcgtatcgactc
ttgcgactctgcgagggggacaaagctgcggctgtgttgatgggctgcgtacaaggtgag
actgccgtcgtcgaggatggcagaacgcaggtgctcagacagaacggccacggttcagct
gcaagcaaagcagccgcgtccaccgagatagatcgcttgctcgaccatcaaatcaaagac
agcttgctccaccacctgctcttggcccgcagttacgccgaatgctcccagtacgcctct
gccgaacatcactttggcgccgtaaccaaactgaaccctttcattgcgtcgcacatggac
gtgtattcgcttgtgctcttccacctctctcgcgaggtcaagctgtctgcattggcgcaa
caccttgccatggttgcgcctaacacggcgtctacgcacattgtcgtcggtaacgcgttt
tcattgcagaaagagcaccagacggcgcttgtgtgttttcagcgtgccgcggcggctgcg
ccagactacgcgtacgcctacacgctcgcgggtcacgaagcgcatgatttggggctgcac
gatgaagcgattgcctacttccgcagcgcgatccgttgcgatcggcgccactggaacgcg
tgggctgggttgggtcgtgtctacctaggcctcggcgagcacgaacacgctgcatgcaag
agtctgcagcaggcgatccacctgaacgcttccaaccacctcctttgggatctggtgggt
tggacgttttcattgctcaatgcaccggccaaggcgctggagtgctacgatcgggcgatc
gaactggcaccgcgggcgtcggtgttgacgtatctgcgtcgagcagagctgttgctgcaa
catggagatgtggactcgagccatcgcgatctggtctgtgcgcacgacttggcgcccgag
gaagcaagcgtgcatatcttgctcgctcagtcgtacatgcgtctcggcggaggtagcttt
tgccacatcgaaggcgctacggccaaagccaaggcgagtggcgtcatgatcttgcccgaa
aagttccaagccgaaatcagccatcacctgagcgttgcggtagatctggaccctacgctc
ttgcgtctcgtcaagagcatctgtgaaggctacaagtgtttgcctgggagcaagctggtg
cctaacgaattgtcgttgatggactcgatcacaatcgatgaaagccagccaagcgcgttt
gcgcacatgcagcgcgagtcgagcaggctcgccaactcgaccgcgcaccacctcgtgcac
gttgctccaggcgctctgcaacctccaccgccagattttgccagcagcctccccacgcac
aacgacgcaagcagctggctccaccgcgcgaattccagcctggatatcgtcctgcacgac
acagatgtttccatctga

DBGET integrated database retrieval system