KEGG   Ustilago maydis: UM02102.1Help
Entry
UM02102.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UM02102.1
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UM02102.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 727 aa AA seqDB search
MSPISPSQFVSRQDQPIVIDDNDEDDNGVASTSVRHPPAQSPTTSLRGITPAMSVATTST
SSINPADERNSASGPPSSLDRYRTGYVYSADMMLHVNPIDPDHPERPLRIFKIFMKFKES
NLFARMKRVPIREVAEEEVKLVHDHGIWEGVQRLAFYHPDVLKEQVQLLETNSSLYINEH
SAYAARLSCGGAIELVNAVAAGQIQNGFAIVRPPGHHAEPQKSMGFCFFNNVAVATRVVL
RRHAHIKKVLILDWDVHHGNGTQRAFEYDDNVLYISLHRYDEDGSFYPGSTYGNFDSAGT
GPGEGRSVNIPWLSQGMGDADYLYAFNHLVMPIAHEFQPDLVIISAGFDAADGDPIGLNR
VSPGGFAQMTHLLTSLSQGKVAVVLEGGYNPEAVASSALAVVDVLLSRNTAEPLETVAST
SAAATVHCVRRFHQKWWKSLRSSPLEADEADIAVAPIDVGRILAAFRTETVAQQYDLLEV
PLQHTPHSRFGGQVLVSDRILDKFSTILFFVHDMGNWRSERPQPSMRAEQMALQLVDASR
GIMDYARARGFGLVDVNINREFSTTRLKLPPGVREPPRHDEEASAAAAFIWDNVVSLATG
PVGPPKIVMVGFGSGCRALTSIIDERNVELCVHAIVNVVGYEDMPHLALAAGVEKKKWYY
RRTMVLAPADHRHLVERADAAPLKRFGRITPVHDTAAINILAHKTADIQTFIDKKLQVAK
KSTSTTL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaatatcaccgtcgcagtttgtatctcgccaggatcagcccatcgttattgac
gataatgacgaagacgacaatggtgtagcctcgacgtctgtcaggcatccgccagcacag
tcccctactacgtctctgcgaggtatcacccccgcgatgtcggtagcaaccacgtcaaca
agtagcatcaatccagctgacgaacgcaatagtgcatccggtccgccatcttcgctcgat
cgctaccgcactggctacgtgtattcagccgacatgatgctgcatgtcaatccgatcgat
cccgatcatcccgagcggccccttcgaatctttaagatctttatgaagttcaaggagagc
aacctattcgctcgaatgaaacgagtcccgatccgagaggttgcggaagaagaagtcaag
cttgttcacgatcatggaatctgggaaggagtacagcgattggctttctaccatcctgat
gtactcaaggagcaggtccaattgctcgagacgaatagctccttgtacatcaacgagcat
tccgcgtatgcagcgaggctttcttgcggcggagcaattgagctcgtaaatgccgttgca
gctggtcagatccagaacggatttgccatcgtcaggccaccaggacaccacgcagaaccg
cagaaaagtatgggcttctgcttctttaacaacgtggcagtagcgactcgggttgtgctg
cggcgacacgcacacattaagaaggttcttatcctggattgggacgtgcatcacggcaac
ggcacacagcgggctttcgagtacgacgataacgtgctttacatctccttacaccgatac
gatgaggatggaagtttttaccctggcagcacctacggaaatttcgatagcgccgggacg
gggcctggagagggcaggtcggtcaacataccatggcttagtcaaggcatgggcgatgcc
gactacctgtatgcgttcaatcatctcgtgatgccgatcgcgcacgagtttcaaccggac
cttgtcatcatttcggctggttttgatgcagctgatggcgacccgattggtctcaaccgt
gtttcaccgggaggatttgcgcagatgacgcacctcctcacatcactctctcagggaaaa
gtagcggtggttcttgagggtggttacaatcccgaggctgtcgccagcagcgctttagcg
gtggtcgacgtcctgttgtcacgcaatacggccgagccactcgagacagtcgccagtacg
tcggcggctgccaccgttcactgtgtacgtcggtttcaccaaaagtggtggaaatctctt
cgctcgtcgccgttggaagccgacgaggcggatatcgcagttgcacctattgatgtgggc
cggatccttgcggcgtttcgcactgaaacggttgctcaacagtacgacctgctcgaagtg
cctcttcaacacacgcctcacagccggttcggagggcaagtgttggtgtcggatcgtatc
ttggacaagttctcgactatcctgtttttcgtgcacgatatgggtaactggcgttcagag
cggccacaaccgtcgatgagggcggagcagatggctttgcaactggtggatgcttcgcgt
ggtatcatggactatgctagggcgaggggtttcggtctggtggatgtcaacatcaacagg
gaattctcgacgacgaggctgaagcttcctccaggcgttcgggaaccacctaggcacgat
gaggaagccagtgccgccgcagcgtttatctgggacaatgtggtatcgctcgcaacgggc
ccagtaggaccgcccaagatcgtcatggtaggcttcggaagtgggtgtcgcgccttgact
tcgatcatcgatgagagaaatgtcgagttgtgcgtgcatgcaatcgtcaatgtggtagga
tacgaagacatgccccacttagccttggcagctggggtcgaaaagaaaaaatggtactat
cgcaggacaatggtgcttgcgcctgcggaccatcgacatctggtcgaacgagccgacgcg
gcgccactcaagaggttcggcaggatcaccccagtccatgacaccgctgccatcaacatc
ctcgcccataagaccgccgatatccagacctttatcgataaaaaactccaagtcgcaaaa
aagtctaccagcacaaccctctga

DBGET integrated database retrieval system