KEGG   Ustilago maydis: UM02269.1Help
Entry
UM02269.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 443 aa AA seqDB search
MGAYRFVLVKPAVRPAYPLLGVFPLPVTLPTQALLAVGVVLIVAFAVAIYSDMLKPGLQA
ASRLHPCTPSASSDRSQPLRRARSANLSNSTSRASSLSSTAPRTRLSSPKYKGLRNTGNT
CFFNSTLQSISSLTLYRKYLYLLVHEAERWDTPTPVIDALLELIEELATPGDRNAAINPV
QLVRALQNLPSSSIRSLVGAHQQQDAHELFAFLNEAVDVEAKAIQQERSASLEAEQAGLR
ALMAPSLPWGGRGVYADPAQAKPNPNLMSNGALNPLHMHGVPHNVNDATGLDTSNSNSDH
VLMISPFDALLAQRTICLDCGYCEAIRHFSTSEISLSVPAFNVRTRTSDITGTSACSLQE
CLALWSELEQVDWICWNCTLHNSLQAVKVDIASKGAAAATVKPNDHDLSATADIDVASQP
VVLLNLFVGAVKEQSTRSLSRIP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggagcataccgcttcgtgctcgtaaaacctgcggtcaggcctgcctatccactcttg
ggcgtgtttcccttgccagtcacactacccacacaagcattgctcgcggttggcgtcgtc
ctcattgtcgcttttgccgttgccatatatagcgatatgctcaaaccaggtctgcaagca
gcatctcgcctccacccatgtaccccttcggcttcgtccgacagatcgcagccattgcgg
cgcgctcgttccgctaatctttccaactctacatcgagagcctcttctctgtcttcgaca
gcgccaagaactcggctgtccagtccgaaatacaagggtcttcgcaacactggaaacacg
tgcttcttcaattccaccttacaatccatctcgtccttgacactctatcgaaagtacctg
taccttttggtgcacgaagccgaacgatgggatactccaacgccagtcatcgatgcactt
cttgagcttatagaggaactcgccacacccggagatcgcaatgcggccatcaatccggtg
cagctcgtccgagcgcttcaaaacttgccgtcgtcttcaataagaagcctcgtaggcgcg
caccagcagcaggacgctcacgagctctttgcgttcctcaacgaggccgtcgatgtcgag
gcaaaagcgatacagcaggaacgatcggcctcactcgaggcagaacaagcagggcttcga
gcgctcatggcgccatctttgccttggggtggtcgcggtgtctatgcagatccagcgcaa
gctaagcccaaccctaatctcatgagcaatggtgctttaaatccattgcatatgcacggc
gtaccacacaatgtcaacgatgctacaggtttagatacatcgaactcgaacagcgatcac
gtcctcatgatctcacccttcgacgccctcctggcgcagcgcaccatctgtcttgactgc
ggatactgcgaagccatccgccacttttcaacttccgagatctccttgtccgtaccagca
ttcaatgtacgcacacggacgtcggatatcacgggcacctcggcgtgctcgcttcaggag
tgtcttgcattgtggtccgagttggagcaagtggattggatctgctggaactgcactttg
cataattcattgcaagcagtcaaggtcgacattgcctccaagggcgcagctgccgcaacg
gtgaagccgaacgatcatgatctctcggccaccgcggatattgacgttgcatctcaaccg
gtcgtcttactcaacctcttcgtgggcgccgtcaaagaacagtcgacacgttctctttcc
agaataccttga

DBGET integrated database retrieval system