KEGG   Ustilago maydis: UM02340.1Help
Entry
UM02340.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     UM02340.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UM02340.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 550 aa AA seqDB search
MASTIPIKVKHNGKLHEINLDTAQPATAFKQAIYEKTGVPSDRMKVMVKGGMLKDDHDLT
KIGARAGQTFMVIGTAGELPKAPTGAITFIEDMTDSELALATKSRVGLTNLGNTCYLNAT
LQVLRAIPELQTALGQFDGNLGGADGERNLTAALRDLYKNLSETTEPFPPFAFLTILRQV
APQFAEMTRDGHGFAQQDAEEVWVRIIQALQNSLDGLSGEATLDPSRKFVQQYLTGHMVI
KRSTAEAPDEPASISKDPFSILQCNISSTTNEMTSGILDSLNQQVEKTSSTLNRTAVYDE
TSRIDRLPAYLATHFVRFYWRRDINKKTKIMRKVKFPFVLDATPFLSDELKEKTKQTNLV
MKNIEKERDERAKIRKRAKASKIAQEKAAREAKNGSDVGIADASSSGVVVREAEAQDGES
GARAKLAMVLTEEQELAERAKEREAIRASMHPDLLADTGCNVSALYELVGVVTHKGAAAD
AGHYISWVRADLDQPRHPSARDLDQSDADQHWYKFDDDKVSRVSKDKIHALDGGGEDSVA
YILLYRSKSL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacaatccccatcaaagtcaagcacaatggcaagctgcacgaaatcaacctc
gacacagctcagcccgccactgcattcaaacaggccatctacgaaaaaacgggagtgcct
tcggatcgcatgaaggtcatggtgaaaggtggcatgctaaaggacgatcacgacctcacc
aagatcggtgcacgcgcaggacagacgttcatggtcatcggcacagcgggcgaattgccc
aaggcgcctacgggagcgattacattcattgaagacatgacggactccgagcttgcgcta
gcgaccaagtcgagagtgggtctgaccaatctgggcaacacgtgctatctgaatgcgacg
ttgcaggtgctgcgtgcgattccagagttgcagacggcgcttggtcagtttgacggcaac
ctgggcggcgcggatggcgaacgcaatttaacggctgctttgcgggatctgtacaagaac
ctgtccgagaccaccgagccttttccgccttttgcgttcttgaccattttgcgacaggtg
gcgcctcagtttgccgagatgacgcgcgacggtcacggtttcgcgcagcaggacgccgag
gaggtgtgggtgcgaatcatccaggcgctccaaaacagccttgatgggctctctggtgaa
gctacgctggacccatcgcgcaaatttgtccaacagtaccttaccggccacatggttatc
aaacggtccactgccgaagcacccgacgagccagcgtcgataagcaaggatccgttctcg
atcttgcaatgcaacatttcgtctaccaccaacgagatgacctctggcattctcgactcg
ctcaaccagcaggtcgaaaagacgtcttcgacgctcaatcgcactgccgtgtacgacgaa
acgtcacgcatcgatcgactgcccgcctacctggccacgcactttgttcgattctactgg
aggcgcgacatcaacaagaaaaccaagatcatgcgcaaagtcaagttcccgtttgtccta
gacgctacgccgttcctgtcggacgaactcaaggaaaagaccaagcagacgaatttggtc
atgaagaacatcgagaaggagcgcgatgagagggccaagattcgcaagagggccaaggcg
agcaagattgcgcaagaaaaagcggccagggaggccaagaacgggagtgatgtgggtatc
gcggatgcgagctcgagtggtgttgtggtgcgcgaagctgaggcgcaagatggcgaaagt
ggtgcgcgcgctaagctcgcgatggtgctgacggaagagcaagagttggctgagcgcgcc
aaggagcgtgaggcgattcgagcatcgatgcatcccgacttgcttgctgatacgggatgc
aacgtgtctgcgctgtacgagcttgtgggcgttgtcactcacaaaggcgccgccgccgac
gctggtcactatatctcgtgggtccgagccgacctcgatcaaccgcgccatcccagcgct
cgcgatctcgaccaatccgacgccgaccagcactggtacaagttcgacgacgacaaagtc
tcgcgtgtctcaaaagacaaaatccacgccctcgacggcggcggcgaggacagcgtcgcc
tatatcttgctatacaggtccaagtctctctag

DBGET integrated database retrieval system