KEGG   Ustilago maydis: UM02357.1Help
Entry
UM02357.1         CDS       T01021                                 

Definition
similar to mitogen-activated protein kinase-like protein HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UM02357.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     UM02357.1
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   UM02357.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 358 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSANDQLTSTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHIRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDVWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDEVIKT
ICSENTLRFVQSLPKRERVPFSQKFKNADPMALDLLEKMLVFDPRTRISAAEALAHPYLA
PYHDPTDEPEAEEAFDWSFNDADLPVDTWKVMMYSEILDFHNIDNSGQDEGPVPPVNN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccgactttgtcaagctctccatttttggtaccgtctttgaggtcaccacccgatat
gtcgacttgcagcccgtcggcatgggcgctttcggtctggtctgctccgcaaacgaccag
ctcacaagcacctcggttgccatcaagaagatcatgaaacctttttccactcccgttctc
tccaagcgtacctaccgagagctcaagctgctcaaacacattcgtcacgaaaacattatc
agcctcagcgacattttcatctcgcctcttgaggatatttactttgtcaccgagctcctc
ggcactgatctccaccgactgctcaccagccgtccactcgagaagcaattcattcagtac
ttcttgtaccagatcctccgaggtctcaagtacgttcactcggccggtgtcgtccaccgt
gacttgaagccaagcaacattctcgtcaacgagaactgcgatctgaagatctgcgacttt
ggtcttgcccgtatccaggacccccagatgaccggttacgtcagcacaagatattaccgt
gcccccgaaatcatgctcacctggcaaaagtacgatgtggctgtcgatgtttggagtgca
ggttgcatttttgcagagatgcttgaaggcaagccgctcttcccaggaaaggaccacgtc
aaccaattctccattatcaccgagctgctcggcaccccaccagacgaagtcatcaagacc
atctgttcggaaaatacgcttcgattcgtccagtcgctgcccaagcgagagcgtgttcct
ttctcacaaaagttcaagaacgccgacccgatggcgttggatctcctcgaaaaaatgctc
gtctttgaccccaggacacggatcagcgccgccgaagcgctcgcacatccctacctcgct
ccttaccacgaccctaccgacgaaccagaggctgaggaggcttttgactggtccttcaac
gatgccgacctacctgtcgacacatggaaggtcatgatgtactctgaaatcctcgacttc
cacaacattgacaattcgggtcaagacgagggtcccgtgccgcccgtcaacaattaa

DBGET integrated database retrieval system