KEGG   Ustilago maydis: UM02357.1Help
Entry
UM02357.1         CDS       T01021                                 

Definition
similar to mitogen-activated protein kinase-like protein HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:uma04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 358 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSANDQLTSTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHIRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDVWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDEVIKT
ICSENTLRFVQSLPKRERVPFSQKFKNADPMALDLLEKMLVFDPRTRISAAEALAHPYLA
PYHDPTDEPEAEEAFDWSFNDADLPVDTWKVMMYSEILDFHNIDNSGQDEGPVPPVNN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccgactttgtcaagctctccatttttggtaccgtctttgaggtcaccacccgatat
gtcgacttgcagcccgtcggcatgggcgctttcggtctggtctgctccgcaaacgaccag
ctcacaagcacctcggttgccatcaagaagatcatgaaacctttttccactcccgttctc
tccaagcgtacctaccgagagctcaagctgctcaaacacattcgtcacgaaaacattatc
agcctcagcgacattttcatctcgcctcttgaggatatttactttgtcaccgagctcctc
ggcactgatctccaccgactgctcaccagccgtccactcgagaagcaattcattcagtac
ttcttgtaccagatcctccgaggtctcaagtacgttcactcggccggtgtcgtccaccgt
gacttgaagccaagcaacattctcgtcaacgagaactgcgatctgaagatctgcgacttt
ggtcttgcccgtatccaggacccccagatgaccggttacgtcagcacaagatattaccgt
gcccccgaaatcatgctcacctggcaaaagtacgatgtggctgtcgatgtttggagtgca
ggttgcatttttgcagagatgcttgaaggcaagccgctcttcccaggaaaggaccacgtc
aaccaattctccattatcaccgagctgctcggcaccccaccagacgaagtcatcaagacc
atctgttcggaaaatacgcttcgattcgtccagtcgctgcccaagcgagagcgtgttcct
ttctcacaaaagttcaagaacgccgacccgatggcgttggatctcctcgaaaaaatgctc
gtctttgaccccaggacacggatcagcgccgccgaagcgctcgcacatccctacctcgct
ccttaccacgaccctaccgacgaaccagaggctgaggaggcttttgactggtccttcaac
gatgccgacctacctgtcgacacatggaaggtcatgatgtactctgaaatcctcgacttc
cacaacattgacaattcgggtcaagacgagggtcccgtgccgcccgtcaacaattaa

DBGET integrated database retrieval system