KEGG   Ustilago maydis: UM02376.1Help
Entry
UM02376.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
uma  Ustilago maydis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UM02376.1
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UM02376.1
Enzymes [BR:uma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     UM02376.1
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     UM02376.1
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     UM02376.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 828 aa AA seqDB search
MSAPTEGLVSVASNVQPQAISIGSRAAKGKTVLIDNYDSFTYNVVQFLAEAGADLVVFRN
DKITLEEIEALNPANIVISPGPGHPLHDSGISIPCIKHFAGKIPILGVCMGLQSIYSAYT
GVVEFAGEIVHGKTSEIAHDGKGLYAGLPAQGVIGTRYHSLAAQLPSLPKELVVTSKTAS
GVVMGIRHTRYTVEAVQYHPESILSVGGREMMVNFLSWTGGTWDANPQAKVDAAAIERAE
STTEPVLAMASTEAANGQPTPAAAGSVGTILERIHVQRLKDIAATKAIPGFSQRDLDIAL
SLHLAPPLINFPERLQRHASRGLPGVMAEMKRASPSKGDIDPTAHAGAQALAYARGGASV
ISVLTEPKWFKGTMHDLSLARRAVDNLPDRPAILRKDFIVDTYQIAEARLAGADTVLLIV
AMLTDEHLKELYDYSLSLGMEPLVEVNNPEEMTRAIRLGAKVVGVNNRNLHDFNVDMETT
SRLADAANKGGVILCALSGISGRSDVAKYLKEGVGAVLVGEALMRAKDKRAFIHDLLGLP
STSTAVESLPGSVVGHASLVKICGLSTVEAAVTAAEAGADMLGMILAPGTKRTVSLEQAA
EIIKAVRSLPAFESAAPVTLDADAVAGSIEQGVTPEDWFSLTVKKLRSRAGRRPLLVGVF
RDQPLAEVASTAERLGLDVVQLHGRSEGTEWAKFLPGRLVIRVFSVKPGAGLGKDLLREV
SRPGYHHIAALDTAAAGGDGGTGVSFDWSIANQIRNADPLPGVVGGSALRSMPVLLAGGL
TAENVAQAIKVAQPFAVDTSSGVETDGNKDLAKIKAFVLAARTASSLA
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctcctaccgaagggctcgtctcagtagcttccaatgtgcaaccccaggccatt
agcatcggatcgcgcgccgcgaaaggcaagactgtcttgatagacaactacgacagtttc
acctacaatgtcgtccaattcctcgcggaagctggcgctgaccttgtcgtttttcgcaac
gacaagatcaccctggaagagatcgaggcactcaatcctgccaatattgtcatcagccct
ggccccggtcaccctctccatgactcaggtatttccattccgtgtatcaagcactttgcc
ggcaagattcccattctcggcgtctgcatgggcctccagtcaatttactcggcctacact
ggtgtcgttgaattcgctggcgagatcgtccatggcaagacatccgagatcgctcatgac
ggaaagggtctttacgcgggccttcccgcccaaggcgtgattggcacgcgctaccacagt
ctcgctgctcagcttcctagcctgcccaaggagctcgtagtcacttccaaaaccgccagc
ggtgtcgtcatgggcatccgtcacactcgttacactgttgaagccgtacagtaccatccc
gagagtatcctcagcgttggaggccgcgaaatgatggtcaactttctcagctggaccggc
ggtacctgggacgccaatccacaggccaaggtcgatgccgctgctatcgagcgcgccgaa
agcaccaccgagcctgtccttgctatggcctctactgaagctgccaacggtcagcccaca
ccagctgctgcgggcagtgtcggcaccattctcgagagaattcatgtgcagcgactcaaa
gacattgctgccaccaaggccattccaggcttctctcagcgtgatcttgatatagctctc
tcgctgcacctcgcacctcctctgatcaacttcccagagcgtctccagcgacacgcctct
cgtggcttgcccggagtcatggccgagatgaagcgtgccagtcccagtaagggcgacatc
gatcccaccgcccacgctggcgcccaagcgcttgcatacgctcgcggaggtgccagcgtt
atcagtgttctcactgagcccaagtggttcaagggtacgatgcatgacctatcgctcgca
agacgagcggtcgataacctaccggatcgccccgccattctgagaaaggacttcatcgtc
gacacttaccaaattgccgaagccaggcttgctggtgccgacacggtgctgctcatcgtt
gccatgctcacggacgagcacctcaaggagctctacgactacagtcttagcctgggcatg
gagccgctcgtggaagtcaacaatcccgaagaaatgacgcgcgccattcgactcggtgca
aaggttgtcggcgtcaacaatcgcaacctccatgactttaatgtcgacatggagaccact
tcgcgacttgccgacgctgccaacaagggcggtgtcatcctttgtgctcttagcggtatc
agcggtcgcagcgatgtagccaagtatctcaaggagggcgttggcgccgtcctggtaggc
gaagcgctgatgcgtgccaaggacaagcgcgctttcattcacgatctgctaggtctccct
tccaccagcacggccgtggaaagtctgcctggatccgttgtgggtcacgcctcgcttgtt
aagatctgtggtctgtcgacggtggaggcggcggtcactgctgccgaagctggagctgat
atgctgggcatgattctcgctcccggcactaagcgcactgtctcgctcgagcaggcagct
gagatcatcaaggctgtccgttcgcttcctgcctttgaaagcgccgccccggtcaccctc
gatgctgatgcggttgctggctccatcgagcagggcgtgactccggaagactggttctcg
ctgacagtcaagaagctgcgctcccgagcgggtcgcagacccctgctcgtcggtgtcttc
cgcgaccagccacttgccgaagtagcaagcacggccgaacgtcttggcctcgatgtagtc
cagctgcacggccgtagcgaaggtacggaatgggcaaagttcctccctggtcggctagtc
attcgcgtcttttcggtcaagcctggagctggattgggcaaagacttgctccgggaagtg
agccgaccggggtaccaccacattgcggcattggacaccgcagctgctggtggagatggt
ggcacgggtgtgtcgtttgactggtccatcgcgaatcagatcaggaacgctgatcctttg
cccggtgtagtgggcggttcggcgttgaggtccatgccagtgttgcttgctggcgggctc
acagctgagaacgtcgcacaggcgatcaaggtggcccaaccgttcgcagttgataccagc
tccggcgtcgagaccgacggcaacaaggacctcgctaagatcaaggcgtttgtcctcgct
gctcgcactgcttcctccctagcttga

DBGET integrated database retrieval system