KEGG   Ustilago maydis: UM02377.1Help
Entry
UM02377.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     UM02377.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 398 aa AA seqDB search
MASLRTGLRVAQPLRASARNFATRPSIRSSVRHYSSPAPGSPPPPQPSSSSSTSKVLLTS
VAIAAAAGGAFLAFGRDDKVSILGVGANGANKFQGSKGSVGPATTSAHSKADYQAVYNAI
AEQLEANPDYDDGSYGPVLVRLAWHASGTYDKNSNTGGSNGATMRFAPESEHGANAGLGA
ARDFMEKIHQKFPWITYSDLWTLGGVAAIQELGGPKIPWRPGRKDATADKCTPDGRLPDG
DKGPDHLRYIFYKMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFAPTSFTNEYFNLLM
NEKWNIRKWNGPPQFEDKSTKSLMMLMTDMALVQDPSFKKHVQRYAKSEDEFFNDFRSAY
AKLLELGVPAENFKAFETKLDGGKPFEFATSAEQENAN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgctccgcactggtctccgtgttgcgcagccgttgcgagcatcggctcgtaac
ttcgctactcgtccctcgattcgttcgagcgttcgtcactacagctcgcctgctcctggt
tcgccacctcctccgcaaccatcgagcagctcgtcgaccagcaaggtgctgcttacctcg
gtcgccattgctgctgccgccggtggtgctttcctcgcatttggccgcgacgacaaagtg
tcgatcctgggcgtcggcgcaaatggcgccaataagttccagggctctaagggctcggta
ggccctgccaccaccagcgctcactccaaggccgactaccaggctgtctacaacgccatc
gccgagcagctcgaggcaaaccccgactacgacgacggctcgtacggccctgtcctcgtg
cgtctcgcatggcacgcttcaggtacctatgacaagaacagcaacaccggcggctccaat
ggtgccacaatgcgattcgcccccgaatctgaacacggcgctaacgctggtctcggtgct
gcccgtgacttcatggagaagattcatcagaagttcccgtggatcacctactctgatctc
tggacgctcggaggtgtcgctgccattcaggagcttggcggccccaagatcccttggcgc
cctggccgcaaggatgctaccgccgacaagtgcactcctgatggccgacttcccgacggt
gacaagggtccagaccaccttcgatacatcttttacaagatgggcttcaacgaccaggaa
attgtggcactctcgggtgcgcatgctctcggccgatgccacacggaccggtccggattc
gatggcccttggacttttgctcctacgtcgttcaccaacgaatactttaacctgcttatg
aacgaaaagtggaacatccgaaagtggaacggccctcctcaattcgaggacaagtcgacc
aagagcctcatgatgctcatgaccgacatggctctggtgcaggacccttcgttcaagaag
cacgttcagcgctacgccaagagcgaggacgaattcttcaacgacttccgcagtgcctac
gccaagctacttgagctcggtgtcccagctgaaaacttcaaggctttcgagaccaagctc
gacggtggcaaaccgttcgagtttgctacttcagctgagcaggagaacgccaactaa

DBGET integrated database retrieval system