KEGG   Ustilago maydis: UM02443.1Help
Entry
UM02443.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
uma  Ustilago maydis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UM02443.1
Enzymes [BR:uma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     UM02443.1
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   UM02443.1
  Exosomal proteins of colorectal cancer cells
   UM02443.1
  Exosomal proteins of bladder cancer cells
   UM02443.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 487 aa AA seqDB search
MRPLFYAPALTLTPLFVAAVFYRPSVPAQQPLMLVEFYAPWCGHCKALAPEYEKASTELL
ADKIKLAKVDCTEENELCAEHGVEGFPTLKVFRTGSSSEYNGNRKADGIVSYMKKQALPA
LSELTADSYADFKSKDRVVAIAYLDSSDKAHLDAVNAVANNLRDNYLFGVVHDAAVAEKA
GVTAPAFVVYRQFDEPEVKFDGKSFNEEAITNFIKAESIPLIDELNAENFMSYAESGLPL
AYLFADPESKDLKSTVESLKSLARANKGKLNFVWIDGVKYSAHAKSLNIQGEDWPAFAVQ
DIEQNLKFPLEDLSGDLVAKVTDFVSQYTSGSLKPSVKSEPIPKDQDGPVHVLVADEFDA
VIGDDSKDKLVEFYAPWCGHCKKLAPTYDTLGEKYKAHKDKVLIAKMDATANDIPPSAGF
QVQSFPTIKFQAAGSKDWIEFTGDRSLEGFVDFIALNGKHKVSVDLDPINVTEQAAPAKE
APHHEEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctctcttctacgctcctgctttgacgctcacaccgctcttcgttgctgccgtc
ttttaccggccttccgttcccgctcaacagcctctgatgctcgtcgaattctacgcccct
tggtgtggtcactgcaaggcactcgcccccgagtacgaaaaggcttccaccgagctgctt
gcagacaagatcaaacttgctaaggtcgactgtaccgaggagaacgagctgtgcgctgag
cacggtgtcgagggtttcccaacgctcaaggtgttccgcacaggctcctcgtcagagtac
aacggcaaccgaaaggccgacggtatcgtttcgtacatgaagaagcaagccctccccgcg
ctctctgagttgaccgcagacagctacgctgacttcaagtccaaggaccgtgttgtcgcc
attgcctacctcgactcttcggacaaggctcacctcgacgccgtcaacgctgtcgccaac
aacctgcgcgacaactacctatttggtgttgttcacgatgcagcggttgccgagaaggcc
ggtgtcactgcgcccgcctttgtggtctaccgtcaattcgacgagcccgaggtcaagttt
gacggcaagtcgttcaacgaggaggccattaccaactttatcaaggccgagtcgattcct
ctgatcgacgagctgaatgccgaaaactttatgagctacgccgagtcgggtcttccgctc
gcctacctgtttgctgaccccgagtccaaggacctcaagtcgaccgtcgagtcgctcaag
tcgctggccagggccaacaagggcaagctcaactttgtgtggattgacggtgtcaagtac
tctgcgcacgccaagtcgctcaacatccagggcgaggactggcccgctttcgccgttcag
gacattgaacagaacctcaagttcccccttgaggacctctccggcgatcttgtcgccaag
gtgacagactttgtttcccagtacacttcgggatcgctcaagccttcggtcaagtcggag
cccatccccaaggaccaggatggacccgtccacgtccttgtcgctgacgaatttgacgct
gtcatcggtgacgacagcaaggacaagctggttgagttctacgctccgtggtgcggacac
tgcaagaagctcgcccccacctacgacaccctgggtgagaagtacaaggcacacaaggac
aaggtgttgatcgcaaagatggacgctaccgccaacgacattcccccctcggctggtttc
caggtgcagtcattccccaccatcaagttccaagcggccggcagcaaggactggatcgag
ttcaccggtgaccgctcgctcgagggctttgtcgacttcattgcccttaacggcaagcac
aaggtttcggtcgacctcgatccgatcaacgttaccgagcaggccgcccccgccaaggag
gctcctcaccacgaggagctatga

DBGET integrated database retrieval system