KEGG   Ustilago maydis: UM02500.1Help
Entry
UM02500.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
uma  Ustilago maydis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UM02500.1
Enzymes [BR:uma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UM02500.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 972 aa AA seqDB search
MDWDHNVTFSAVRSLQATTAVAQATDNVVDLDRNRVDSRPGVLPTKNESSPHSSASLPPP
SPHPPPPPAFTPSPSPSPSPSPQTATARSSVTDAAPAPKRSPRSPLHSNGSFPPVSDPIS
SIDSRDALDIDHESTAMLASSSSARKSKPKLQPQLINHLPLAQQAAMATFHEITFNDYHD
KKLGRPPGKFDDYMICDCTPNSGNLDMACTDYSGCINRMTQIECSASKCRWGKQCRNQRF
HRRQYVDVDIVQTEKKGFGLRACQDIPKETFIYEYVGEVMNQTTFLQRMQQYRIEGIRHF
YFMMLQPNEYLDATKKGGKGRFINHSCNPNCAVSKWQVGKHLRMGIFAKRNIQKGEELTF
NYNVDRYGNDAQECFCGEPNCVGTLGGKTQTDLSGMDDLFLDALGISDEVEQTEAKGSRR
KRGKRLDLDFIPQMRAIQEHEATRVMTAARQAGPKREILEKLLRRMEMTTDVNVQKSLVK
LHGFILMQFLLEQWWNDRDIVILIINVLARWPLIARNKVIDCGVEDQVRILAQTYRPRSP
EDQKPSLDALRQVKQDDSAADRNDYTQVQPTLAPVRIGAPPAPDAEVSARAEHLLEAWKK
LDMTYRIARKDALKPDADDHKDATAVTTWIDRRRMQDLDDPLDLEHAQAPNAVSSELGNA
LSGDQELREIKPSWQPPPAPPSMPNAPAKRMGGAVHHRSPPGSFTPTRLQSSGQSPLTPD
QVTSVLSSSLVKSLSGLVSSLKQQGIQLQQQQQQQPPAQQQPSAQPAAPSAKSIEDIIRE
ANEQEERARKEAEAAAKAARELEVNGGQTSGSSRKRPSSASRHSDKRAKHSSLSSSSQAA
SKLISSNGSAADSTSKAGSVESVAANERRLRKLVGELVVRQMSKYKDDLERESFKRHAKE
LTNAIVGKEMRNPKSWPPARGALTELSLDKRAKIKAFAKEYIDKLLARKGKGKGSSTPSN
NEGAGSSNNGIV
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggattgggaccacaacgtcaccttttctgcggtgagatcgctgcaagccactacggct
gtggcccaagctacagataacgtcgtcgacttggatcgaaaccgtgtcgattcccgtcca
ggtgtcctccccacaaagaatgaatcttccccacactcgtcagcatctttaccgccaccg
tcaccacatcctcctccaccgcccgctttcactccctcgccttcgccttcgccctcgccc
tcgccacaaactgccactgccaggtcgtccgtcactgatgcagctccagcaccaaagcgt
tcgcctcgttcacctttgcactcaaacggcagctttcctccagtctcagatccgatatca
tccatcgactctcgagatgcgctcgacatcgaccatgaatccactgccatgcttgcctcc
tcctcctcggcacgcaagtcaaaacccaagctgcaaccgcagcttatcaaccatcttccc
cttgcacaacaagcagcgatggccactttccacgagatcaccttcaatgactatcatgac
aagaagcttggcagaccgcctggcaaattcgacgactacatgatctgcgactgcacgccc
aactcgggcaaccttgacatggcctgcacagactattccggctgcatcaatcgcatgact
cagatcgaatgctcagcttcaaaatgccgctggggcaaacagtgtcgcaaccagcgcttc
catcgaagacagtacgtcgatgtcgacattgttcagaccgaaaagaagggcttcggcctg
cgcgcctgccaagacatcccaaaagagaccttcatctacgaatacgtcggcgaagtcatg
aaccagaccacctttctccaacgcatgcagcagtatcgcatcgaaggcattcgtcacttt
tatttcatgatgttgcaacctaacgaatatctcgatgcaaccaaaaagggcggcaagggt
cgcttcatcaaccacagctgcaatcccaactgcgccgtctccaagtggcaggttggcaaa
caccttcgcatgggcatctttgccaaacgcaacatccaaaagggcgaggagctcaccttc
aactacaatgtcgaccggtacggcaacgacgcgcaagagtgcttctgcggtgagcccaac
tgcgtcggcactctcggcggcaagacacagaccgacctcagcggcatggatgaccttttc
ctcgatgcgctcggcatctcggacgaagttgagcagacagaagcaaaaggttctcgtcga
aagcgcggaaagcggctcgatctcgactttatcccacagatgcgtgccatccaggagcac
gaagcaacgcgcgtcatgaccgccgctcgccaagcaggtcccaaacgcgagattctcgaa
aagcttttgcgcaggatggaaatgaccaccgacgtcaatgtacaaaagtcgctcgtcaag
ctgcacggctttatcctcatgcagttcttgctcgagcaatggtggaatgatcgcgacatt
gtgattctcatcatcaatgttcttgctcggtggcccctcatagcacgcaacaaggtcatt
gattgcggcgttgaggatcaggttcgcatccttgcccagacctatcgtccacgctcgcca
gaagatcagaaacccagcctcgacgctctacgtcaagtcaagcaagacgactcggctgct
gaccgtaacgactacacgcaagtccagccgacattggcacctgtgcgaataggtgcacct
cccgcaccagacgcagaggtatctgctcgcgccgaacacctgctcgaggcgtggaagaag
ctcgacatgacgtaccgcatcgcacgcaaggatgctctcaaacccgacgctgacgatcac
aaggatgccaccgccgtcaccacgtggatcgaccgcagaagaatgcaggatctcgacgat
ccgctggacctggaacatgcacaagctcctaatgcagtttcttcggagcttggaaacgct
ctctcgggcgatcaagaattgcgcgagatcaaaccgtcgtggcaaccgccacctgcgcca
ccctcgatgccaaatgcaccagcaaagcgcatgggcggtgccgtccaccatcgatccccg
ccaggcagcttcacgcccacccgactccaatcctcgggtcagagtccgcttacacccgac
caggtgacgtctgtcctgtcttcgtcgttggtcaagtcgctttccggcctggtctcatcg
ctcaagcagcaaggtattcagttgcagcagcagcagcagcagcagccaccagcacaacag
cagccatcagcacagcccgctgccccgtctgcaaagtcgatcgaagacattatccgagag
gcaaacgaacaggaggagcgtgcacgaaaggaagccgaggctgccgccaaagcagcacgc
gagctcgaggtcaacggcggtcagacgagcggttcttcgcgcaaacgcccttcttcggca
tctcgtcactcggacaagcgagccaagcactcgtccttgtcgtcatcgagccaggcggca
tcgaagctgatttcgtccaacggttcagctgcagactcaacctcgaaagctggtagcgtg
gaatcggtagctgccaacgaacgacgacttcggaagctggtgggcgaattagtggtacgt
caaatgtccaagtacaaggacgacttggaacgcgagagcttcaaacgccatgccaaggag
ttgacgaatgccattgtaggcaaggagatgcgcaaccctaaatcatggcctcctgcccgc
ggcgctctgaccgaactgtcattggacaaacgggccaagatcaaagcgttcgccaaagag
tatatcgacaagcttttggccagaaagggcaaaggtaaaggctcgagcacaccctcgaac
aatgaaggggcaggaagcagcaacaatggcattgtctga

DBGET integrated database retrieval system