KEGG   Ustilago maydis: UM02512.1Help
Entry
UM02512.1         CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM02512.1
   01230 Biosynthesis of amino acids
    UM02512.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM02512.1
   00030 Pentose phosphate pathway
    UM02512.1
   00051 Fructose and mannose metabolism
    UM02512.1
   00052 Galactose metabolism
    UM02512.1
  Energy metabolism
   00680 Methane metabolism
    UM02512.1
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UM02512.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UM02512.1
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UM02512.1
Messenger RNA biogenesis [BR:uma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UM02512.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 867 aa AA seqDB search
MPPFTPAVRAENTFAAQSTSTKPFSSKFAPASHDGQPRRLAVMTSGGDSAGMNAAVRSVV
KMAIFRGCEAFVIREGWEGLVRGNQTPENTPSATPSVSRSASTFFDSPNIQAKPSHLEAN
PEQSDFVPTYGEGELLREGVGEAQELGLRGRYIIRVGWDDVRGWMDQGGTLIGTARSKTF
RTPEGREQAAYNLIINGIDALAVCGGDGSLTGADKLRAEWPDLVASLKAKSKITEEQATK
FAHLNIVGLVGSIDNDMATTDITIGASTALQRICEAVDSISSTAASHSRAFVVEVMGRHC
GWLALMAGIATGADYVFIPERPPQGEQWHSEMSAVLQKHRDLGKRKSIVIVAEGAIDREL
NDISPEMIKQVLSNDLGLDTRVTTLGHTQRGGKPDANDRILATLQGIEAVDAVLEATPET
PSYVIGISENKITRIPLMFAVEQTQKVAKLIESKDFDGALALRDPEFAEGLRAFKYISQI
TEDEMLPQNKRLRMGVINVGAPAGGMNAATRTAVRYCLAKGHEAVVIYNGFPGLLEDNVS
VLNWLRVDNWATRGGSELGVNRHLPDIDIGAVAAKLQEHKIEGLLIVGGFEAFSSVKILN
DNRDRYPAFRIPIVGLPATISNNVPMNEFSLGSDTSLNALVDACDAVKQSASASRNRVFV
VETQGGKCGYIAVMGALAAGAVLVYTPEVGIGLQQLGKDVAFLKKRFLLDVKGKSEGRLV
IRNEKSSDVFTTEVITKILKEEGNSLFDARSASLGHTLQGGVPSPLDRVRATRLALKCCE
FLESQALKQRSGSSASSKTGSGSSSDKSYSDDTAVMITIQGSTICFTSATEMSRNADMKN
RRGKTAWWHELKALVELLGGRTALAEL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttttacaccggcagttcgtgccgaaaacacctttgccgctcaatccaccagc
accaagcctttttcctccaaattcgctcctgctagccatgacggtcaacctcgcagactc
gccgtcatgacctccggtggcgattcagctggtatgaatgctgcagtccgctccgtcgtc
aaaatggccatcttccgcggatgcgaggcctttgtcattcgcgaaggttgggagggtctc
gttcgaggaaatcagacacccgaaaacaccccctctgcaaccccctcggtcagcaggagc
gcctccaccttcttcgactcgcctaacatccaggccaagccttctcacctggaagccaac
ccagaacagtccgactttgtgccaacatacggagagggcgagctgctgcgagaaggtgta
ggagaggcgcaggaactcggtctccgtggtcgatacatcatccgtgtcggctgggatgac
gttcgcggttggatggaccaaggtggtaccctcatcggcaccgcgcgctccaagaccttc
cgcactcccgagggtcgcgaacaggccgcctataacctcatcatcaacggcatcgacgct
ctcgccgtctgtggtggagacggaagtctcaccggtgctgacaagcttcgtgcagaatgg
cccgacctcgtcgcatcgctcaaggccaagagcaagatcaccgaagagcaagccaccaaa
ttcgcccacctcaacattgttggtctcgttggatccatcgacaacgacatggccaccacc
gacattaccatcggcgcatccaccgctctccagcgcatctgcgaggccgtcgactctatc
tcgtccactgctgcctcgcattctcgtgcctttgtcgtcgaagtgatgggcagacattgc
ggctggctcgccctcatggccggtattgctacgggtgccgactatgtcttcatccccgag
cgccctcctcagggcgaacaatggcactccgagatgtcggccgtccttcaaaagcatcga
gaccttgggaaacgaaaatccatcgtcattgtcgcagagggcgccatcgaccgtgaactc
aacgacatctcgcccgaaatgatcaaacaagtgctctccaacgacctcggtcttgacacc
cgtgtcaccaccctcggacacacccagcgtggtggaaagcccgatgccaacgaccgtatc
ctcgcaacgcttcaaggtatcgaagctgtcgatgccgttctcgaagccactccagagacc
ccctcttacgtcatcggcatcagcgaaaacaagatcactcgtattccgctcatgtttgcc
gtcgaacaaactcaaaaggtcgcaaagctcatcgagtccaaggactttgacggcgcgctc
gcccttcgtgaccctgaattcgccgaaggactccgtgcattcaagtacatcagtcagatc
accgaagatgagatgctgccgcagaacaagcgtctccggatgggtgtcattaatgtcggc
gctcctgctggaggcatgaacgcagccacacgcaccgccgtccgttactgcctcgcaaag
ggccacgaggccgtcgtcatctacaacggcttcccaggtctgctcgaggacaacgtctcg
gtgctcaactggctccgcgtagacaactgggccacaagaggtggctcggaactcggtgtc
aaccgccatctgcccgatattgacattggcgcggttgccgccaagttgcaagagcataag
atcgaaggtcttttgattgtcggtggcttcgaggccttcagttcggtcaagattctcaac
gacaaccgcgatcgataccccgcgttccgcatccccatcgtcggtcttccggccaccatc
tccaacaatgtgcccatgaacgagttttcgctcggctctgatacgtcgctcaatgcgctt
gtcgatgcatgcgatgctgtcaagcagtcggcgtcggcatcgcgaaaccgagtgtttgtc
gtcgagacgcagggtggcaagtgcggctacattgcggttatgggtgcgcttgctgcagga
gctgtgctcgtctacacgcccgaggtgggcatcggcctgcagcagctcggcaaggacgtc
gctttcctcaagaagcgtttcctgctggatgtcaagggcaagtccgaaggaaggctggtt
atccgtaacgaaaagtcatccgacgtcttcaccaccgaggtcatcaccaagatcctcaag
gaggaaggcaacagcctctttgacgcacggtccgctagcctcggacacacgcttcagggc
ggtgtgccttcgccgttggaccgtgtgcgcgccacacgtctggcgctcaagtgctgcgag
ttcctcgagtcgcaagctctcaagcagcggtctggttcttccgcctcgtccaagacgggc
agtggctcaagctcggataagtcgtactcggatgacacggcggtcatgatcaccatccag
ggttccaccatttgcttcacctcagccaccgagatgtcgcgcaatgccgatatgaagaat
cgacgtggtaagaccgcatggtggcacgagctcaaggcgctcgtagagttgcttggtggt
cgcaccgctctcgctgagttgtag

DBGET integrated database retrieval system