KEGG   Ustilago maydis: UM02512.1Help
Entry
UM02512.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM02512.1
   01230 Biosynthesis of amino acids
    UM02512.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM02512.1
   00030 Pentose phosphate pathway
    UM02512.1
   00051 Fructose and mannose metabolism
    UM02512.1
   00052 Galactose metabolism
    UM02512.1
  Energy metabolism
   00680 Methane metabolism
    UM02512.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UM02512.1
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UM02512.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 867 aa AA seqDB search
MPPFTPAVRAENTFAAQSTSTKPFSSKFAPASHDGQPRRLAVMTSGGDSAGMNAAVRSVV
KMAIFRGCEAFVIREGWEGLVRGNQTPENTPSATPSVSRSASTFFDSPNIQAKPSHLEAN
PEQSDFVPTYGEGELLREGVGEAQELGLRGRYIIRVGWDDVRGWMDQGGTLIGTARSKTF
RTPEGREQAAYNLIINGIDALAVCGGDGSLTGADKLRAEWPDLVASLKAKSKITEEQATK
FAHLNIVGLVGSIDNDMATTDITIGASTALQRICEAVDSISSTAASHSRAFVVEVMGRHC
GWLALMAGIATGADYVFIPERPPQGEQWHSEMSAVLQKHRDLGKRKSIVIVAEGAIDREL
NDISPEMIKQVLSNDLGLDTRVTTLGHTQRGGKPDANDRILATLQGIEAVDAVLEATPET
PSYVIGISENKITRIPLMFAVEQTQKVAKLIESKDFDGALALRDPEFAEGLRAFKYISQI
TEDEMLPQNKRLRMGVINVGAPAGGMNAATRTAVRYCLAKGHEAVVIYNGFPGLLEDNVS
VLNWLRVDNWATRGGSELGVNRHLPDIDIGAVAAKLQEHKIEGLLIVGGFEAFSSVKILN
DNRDRYPAFRIPIVGLPATISNNVPMNEFSLGSDTSLNALVDACDAVKQSASASRNRVFV
VETQGGKCGYIAVMGALAAGAVLVYTPEVGIGLQQLGKDVAFLKKRFLLDVKGKSEGRLV
IRNEKSSDVFTTEVITKILKEEGNSLFDARSASLGHTLQGGVPSPLDRVRATRLALKCCE
FLESQALKQRSGSSASSKTGSGSSSDKSYSDDTAVMITIQGSTICFTSATEMSRNADMKN
RRGKTAWWHELKALVELLGGRTALAEL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttttacaccggcagttcgtgccgaaaacacctttgccgctcaatccaccagc
accaagcctttttcctccaaattcgctcctgctagccatgacggtcaacctcgcagactc
gccgtcatgacctccggtggcgattcagctggtatgaatgctgcagtccgctccgtcgtc
aaaatggccatcttccgcggatgcgaggcctttgtcattcgcgaaggttgggagggtctc
gttcgaggaaatcagacacccgaaaacaccccctctgcaaccccctcggtcagcaggagc
gcctccaccttcttcgactcgcctaacatccaggccaagccttctcacctggaagccaac
ccagaacagtccgactttgtgccaacatacggagagggcgagctgctgcgagaaggtgta
ggagaggcgcaggaactcggtctccgtggtcgatacatcatccgtgtcggctgggatgac
gttcgcggttggatggaccaaggtggtaccctcatcggcaccgcgcgctccaagaccttc
cgcactcccgagggtcgcgaacaggccgcctataacctcatcatcaacggcatcgacgct
ctcgccgtctgtggtggagacggaagtctcaccggtgctgacaagcttcgtgcagaatgg
cccgacctcgtcgcatcgctcaaggccaagagcaagatcaccgaagagcaagccaccaaa
ttcgcccacctcaacattgttggtctcgttggatccatcgacaacgacatggccaccacc
gacattaccatcggcgcatccaccgctctccagcgcatctgcgaggccgtcgactctatc
tcgtccactgctgcctcgcattctcgtgcctttgtcgtcgaagtgatgggcagacattgc
ggctggctcgccctcatggccggtattgctacgggtgccgactatgtcttcatccccgag
cgccctcctcagggcgaacaatggcactccgagatgtcggccgtccttcaaaagcatcga
gaccttgggaaacgaaaatccatcgtcattgtcgcagagggcgccatcgaccgtgaactc
aacgacatctcgcccgaaatgatcaaacaagtgctctccaacgacctcggtcttgacacc
cgtgtcaccaccctcggacacacccagcgtggtggaaagcccgatgccaacgaccgtatc
ctcgcaacgcttcaaggtatcgaagctgtcgatgccgttctcgaagccactccagagacc
ccctcttacgtcatcggcatcagcgaaaacaagatcactcgtattccgctcatgtttgcc
gtcgaacaaactcaaaaggtcgcaaagctcatcgagtccaaggactttgacggcgcgctc
gcccttcgtgaccctgaattcgccgaaggactccgtgcattcaagtacatcagtcagatc
accgaagatgagatgctgccgcagaacaagcgtctccggatgggtgtcattaatgtcggc
gctcctgctggaggcatgaacgcagccacacgcaccgccgtccgttactgcctcgcaaag
ggccacgaggccgtcgtcatctacaacggcttcccaggtctgctcgaggacaacgtctcg
gtgctcaactggctccgcgtagacaactgggccacaagaggtggctcggaactcggtgtc
aaccgccatctgcccgatattgacattggcgcggttgccgccaagttgcaagagcataag
atcgaaggtcttttgattgtcggtggcttcgaggccttcagttcggtcaagattctcaac
gacaaccgcgatcgataccccgcgttccgcatccccatcgtcggtcttccggccaccatc
tccaacaatgtgcccatgaacgagttttcgctcggctctgatacgtcgctcaatgcgctt
gtcgatgcatgcgatgctgtcaagcagtcggcgtcggcatcgcgaaaccgagtgtttgtc
gtcgagacgcagggtggcaagtgcggctacattgcggttatgggtgcgcttgctgcagga
gctgtgctcgtctacacgcccgaggtgggcatcggcctgcagcagctcggcaaggacgtc
gctttcctcaagaagcgtttcctgctggatgtcaagggcaagtccgaaggaaggctggtt
atccgtaacgaaaagtcatccgacgtcttcaccaccgaggtcatcaccaagatcctcaag
gaggaaggcaacagcctctttgacgcacggtccgctagcctcggacacacgcttcagggc
ggtgtgccttcgccgttggaccgtgtgcgcgccacacgtctggcgctcaagtgctgcgag
ttcctcgagtcgcaagctctcaagcagcggtctggttcttccgcctcgtccaagacgggc
agtggctcaagctcggataagtcgtactcggatgacacggcggtcatgatcaccatccag
ggttccaccatttgcttcacctcagccaccgagatgtcgcgcaatgccgatatgaagaat
cgacgtggtaagaccgcatggtggcacgagctcaaggcgctcgtagagttgcttggtggt
cgcaccgctctcgctgagttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system