KEGG   Ustilago maydis: UM02524.1Help
Entry
UM02524.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
uma  Ustilago maydis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UM02524.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 2319 aa AA seqDB search
MAVLPTTSSWNAARGIAVFEPARFERLHRLITEAASNPVRISRSNDWFVTIDRSRSDLAD
LGKVRPPSDVERKEIESGKITISGNTQSLNPDFAQQSLLLARELVVSEHFAASLLQQGLA
GRAKWGRPAVEVACILYHRERLALLACLKELLRNALTMPFDEDLEAQRMGLKMEQLVESL
VSIEASVGSTSTSTRKLTLAERILAEIDNVKQSTAHVKASLESPGSNIANQGIQTQTSNF
FGLGSSQTAKQPSSTSTASGGRLSDEIQLDRLGWLREERRELGHLLYLLSISSLLTTSNI
LAILRWLAAVSAETYDEMTIYVLTALLGAIDATPDARAAMADRASRGTLRNTVEALLDDE
SFITVTHAEITRKHWALGELNSAVALQWSIFLVEAFSRNPTYRTQLSISEEQIQDLVLQS
ITGSSLSKDSKATSGEEGPTGGAFIFLVVRVLAFRQKTIDALFGEEEGALTAEADTAAGD
VIDINAWEDEVDAEFREYVVQQIHNLALGTTSVMLPMLRRIQRSEEDAAFALSRAVSARG
STSAPPERRYDIEALFDLIALLCRGRPEAGLPFWVGSDNRPTRFLAWAIDVREPGHQRAL
LNMLAAMSSGPQSASQAYALLDQESSQAGATGEGRLVSWSRFFEWITYYIDTFHQAVNTS
SFHASSYQTLAMPKNEETLLIGFVRLFRNVVYFSHPARDALLQNSSYNALDKLFTLLTCP
IPVELKASILDALSAFLHLSLSNPAAQARFSSIATQLWDRFDECGLIPSDDAAARSRLNS
NTNASGSFGPAFKPLASRGVLYELENFEVPLRTFPGSTSFVNFLKALVQLPSGTLAAGSN
ALTDAPLTSATNANPFSTIVSYDQQAQQQIQGSTQPVYQQQQRRQTRSVEPYVDFVIDHV
FLKARTRDYVEPAEQWRVVASCLDFVERSLRSYDLAALLRSSERADAVTDPALLTQLASH
PGFFLMRRILTGSKMVGEMLGILVPGSGLGAFEAINQNRASTFFYGTSVRHVLSILDRVL
RYQDLFVQVLIPTLVDTTLNGVQLPFDVSTRVGNSGSYSSFDVQLLHAHESVVQIALLIN
CVRDDVALLSVRLLGLIARTAAFSAVDRFGEMGYRRKMNRLVGLLEMSDEASRVRAGYVA
RLEAESSGDAGSAKMLESLNGLAGGLQSDEDEDADLQASNGRLDGITALASSDAVEAIQI
AIVNLLLAGTELNQPAPNVAHLLLGYDLRAVRPEEQVIVDPDAQTTAPSAIHVILALLRP
ESDGDGASFLSLAERSPSFAEKCFSLILRLCTHPFTSAATLRYLRTKEDYVVQQLRSISL
VPAERGALTESSAALGLVQFADGQAIETTIDRVTASLRMRASLLELTALELHSLLNAGMQ
SRAARVVAALFGSNATAGGGNGIDADGSIDEDELLLGTERDFRLGAGGAEIRSFGGVRLL
EILQSLDFEWHDDREALGQNITVITPEQLDLAKRPDAAVGPRLYDLSAVLAILVREKTIL
QQKGNLRDAGQANPFLEQAAFVLQWASAQNAKKAVAFSRRRVLQAWRHTLDMVLARAAGL
LRTEVRSGLMFDCLSELLPRISTPSTDAGALDAPSADLVAGAVLSLLTSLRQHRVELTTG
ALDLETVDALPTDRLLTTLRALIDSILRLETTTLARGNLYSALINFLQLVKSGSGADASD
ETGANDGASIVATDVDDTMSVGGASTTITNIFGGRTQTSSLEARTRTLLLSYLERLMDVL
GRDALDASDLSKTIAFTLLDKLCALDAPPSSGSSSRRGGSRCLDLLDRKGYIKSFVTALR
DSDLALQETLRPDPASLNSLYVYEARLAFFNRMAQSRDGAERLLNAKIFDVLAQSDYLAA
RPDQDQEFVDFDSFLPAATERYNAMLTPVLQLTTSILASTSAGAASQGAFGITKALSSTS
ASSAPRHALALLTAHRDTLLTVLRAPLQEFCSFAQLGQAHLVVAIFVLIMSSLDDDAQQA
PSPLAPYHTAIVAFAAVYLNTMSWQSRVVPCNEAEREESHVPTASLRALRASSEGAHGNG
SVGAEEENAFSAKVSAMVVRLQMALLSYLEAASDARGSNTVRVRPVVAASLTANRERSRT
PYGAGEDGGDGDTSRAGFLRSQRASAAALTVPSIGGLVAALDEYTDSVAKELQALENIET
LFENVDSVRQDELDEIARDALDQVTAGELSAAQRRSVALRQLSSRKATLRASSTSKLDAL
ELILVLLIRHIEFFRTLHADRVSILTSVGTRSSPAALQGAASHLDWNSLMHGLAESLLPV
VDEKIGYLSLPPSLVANARERQSFLQMAGRRLASFFTEQ
NT seq 6960 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccttcctaccacctcctcttggaacgccgctcgcggcatcgccgtcttcgag
cccgcacgcttcgagcgcctacaccggctcatcacggaagctgcatccaaccctgtccga
atctcacgctcgaacgactggttcgtgaccatcgatcgcagccgctctgaccttgcagac
ctcggcaaggtccgtccaccatccgatgtcgagcgcaaagagatcgagtccggcaagatc
acaatcagcggcaacacgcaaagcctcaaccctgactttgcgcagcagtcgctcttgctg
gctcgcgaattggtcgtctcggagcactttgctgcttctttgctccagcaaggtcttgct
ggtcgtgcaaaatggggccgtcccgccgtcgaggtcgcttgcatcctctatcaccgcgaa
cgacttgcattgcttgcgtgcctcaaggagctactccgtaatgcactcaccatgcctttt
gacgaagacctagaagcccaacgcatgggtctcaagatggaacaactcgtcgaatcgctc
gtcagcatcgaggcttcggtcggctccacttccacatccacacgcaagctcacgcttgcc
gaaaggatcctcgctgaaattgacaacgtcaaacagtccactgcacatgtcaaggcatct
ctcgaatcgcctggctccaacatcgcaaatcaaggcatccagacacaaacgtccaacttc
ttcggtcttggtagtagccaaaccgcaaaacagccatcatccacatccactgccagcggt
ggcagactcagcgatgagatccaacttgaccgtcttggatggctgcgcgaagaacgacgc
gaacttggtcacctgctttacttgctgtccatctcgtctcttctaacaacctccaacatt
ttggccatcctccgttggctggctgccgtctcggcagaaacgtacgatgagatgaccatc
tacgtcctcactgccctcttgggggcgatcgatgcaactccagatgcaagagccgccatg
gcggatcgcgcaagtcgaggcacactccgcaacactgtcgaagcgctgctcgacgacgag
tcgtttatcacagtcactcacgccgagattactcgcaaacactgggcccttggcgagctc
aacagtgctgttgctcttcaatggtccatcttcttggtggaagcattttcacgtaacccg
acctatcgcacccagctttctatttccgaagagcagatccaagatcttgtgctccagtcc
atcaccggctcatccctctccaaggactcgaaagccacaagtggcgaggaaggtcctact
ggcggcgccttcattttcctggttgtgcgtgtcctagcctttcgccaaaagaccatcgac
gcgctttttggcgaggaagaaggcgcgctgacggctgaggctgacactgctgctggcgat
gtcatcgacatcaatgcttgggaagatgaggtggacgccgagttccgtgagtacgttgta
cagcagatccacaaccttgctctcggtaccacttcggtcatgctgcccatgctgcgtcgc
atccaacgttcggaagaggatgccgcctttgccctctcgcgagctgtcagtgcacgaggc
agcacatccgcacctccagagcgtcgatacgacatcgaggcgctcttcgacctaattgcc
ctgctctgccgtggccgacccgaagctggtctgcctttctgggtcggatctgacaaccgc
cccacacgcttcctcgcatgggccatcgatgtccgcgagccaggtcaccagcgtgccttg
ctcaacatgctcgccgccatgtcttcgggtcctcagagcgccagtcaggcatatgcgctg
cttgaccaggagagcagccaagccggagctaccggcgaaggccgcctcgtctcctggagc
cgtttcttcgaatggatcacctactacatcgacacgttccaccaggccgtcaacacatca
tcgttccatgcatccagctaccagacactggccatgccaaagaatgaagagacgctcttg
atcggctttgtgcgactcttccgcaacgttgtctacttttcgcatccagctcgcgacgct
ctgctccagaactcatcctacaacgcgctggacaagctctttacgctcctcacctgcccc
attccggtcgagctcaaagcaagcattctcgacgccctgtcggctttcctgcatctctcg
ttgagcaatcctgccgctcaagcccgcttctcttcaatcgcgacacagctgtgggaccgc
tttgacgagtgtggcttgatcccctcggacgatgctgctgcaaggtcgcgtctcaacagc
aacacaaatgcatccggttcgtttggtcccgccttcaagccgctcgcttccaggggcgtc
ctgtacgagctggaaaacttcgaagtgcctctccgcacctttcctggttccaccagcttt
gtcaactttcttaaagcgctcgtccagcttccttccggcacgcttgctgccggttccaac
gcgttgacagatgctcctttgacgtccgcaaccaatgccaatcccttcagcaccattgtt
tcctacgaccagcaggcgcagcagcagattcaaggatcaacacagccagtataccagcag
caacagcgcaggcagacccgttctgtcgaaccctacgtcgattttgtcattgaccatgtc
tttctcaaagcacgaacgcgtgactacgttgagcccgcggaacaatggcgtgttgtggcc
tcatgtctcgactttgtcgagcgttccttgcgttcatacgacttggcagcccttctccgt
agcagcgaacgagcagatgctgtgacagacccagctttgctgacccagctcgcgtcgcat
cccggcttcttcctgatgcgtcgcatcttaacgggatccaagatggttggtgaaatgctt
ggcatcctggttcccggctcgggccttggagccttcgaggccatcaatcagaaccgtgca
agtactttcttttatggcacatccgttcgacacgtcctcagcatcctcgaccgtgtgctt
cgataccaagatctctttgtgcaggttctcattccgacattggtcgacaccaccctgaac
ggcgtccagctaccttttgacgtctcgacccgcgtcggcaactcgggctcgtacagcagc
tttgatgttcagcttttgcatgcccacgagtcagtcgtgcaaatcgcactacttatcaac
tgcgttcgcgacgatgtcgcattgctgtcggttcgcttgcttggactcatcgcgcgcaca
gccgccttcagcgctgtcgaccgttttggcgagatgggctaccgccgcaagatgaaccgt
ctcgtcggcttgttggagatgagcgacgaggcaagccgagtcagggcaggctatgttgca
aggctggaagctgagtcttcgggtgacgccggaagtgcaaagatgcttgaatctctcaac
ggcctcgctggaggattacaatcagacgaggacgaagacgcagatctgcaggcgtccaac
ggcaggctggacggcatcactgctctagcatctagcgatgccgtggaggccattcagatt
gctattgtcaaccttctgcttgctggcaccgagctcaatcagcccgctcccaacgttgcc
cacctcttgcttggctacgacttgcgggccgtgcgacctgaagagcaggtcatcgttgat
cccgatgcacagactactgcgccgagcgccattcatgtcattctagctctcctccgtccc
gagtccgatggcgatggtgcttctttcctcagtctggcggagcgatcgcccagctttgca
gaaaaatgcttctccctcattctgcgcctttgcactcatccatttacaagtgcggcgaca
cttcgttatctgcgcaccaaagaggactacgtggtccagcagttgcgaagcatatcgctg
gtacctgctgagcgtggcgccttgaccgaaagctcagctgctctcggcttggtgcaattt
gccgatgggcaagctatcgaaacgacgatcgaccgcgtcactgcttcactgcgtatgcgc
gcctcgctgctcgagctcactgcgctcgagttgcattcgctactcaacgccggcatgcag
tcgcgagcagcgagggttgttgctgctcttttcggctccaacgccaccgctggcggagga
aatggtatcgatgcagatggcagcatcgacgaggacgagctcttgctcggcaccgaacgc
gattttcgcctcggtgctggtggcgccgaaattcgatcgttcggtggtgtacgcttgcta
gagatcctgcagagcctcgactttgagtggcacgacgaccgggaggcacttggtcaaaac
attaccgtcatcaccccggagcagctcgatctagccaagcgacccgacgctgctgttgga
cctcgactttatgatctttccgcggttcttgctattcttgtgcgagaaaagacgattctc
caacagaagggcaatctgcgcgacgcaggtcaggccaatcccttcttggaacaagccgct
ttcgtgcttcagtgggcttcagcacagaacgccaagaaggcggtcgccttctcgcgtaga
cgtgtgctgcaggcgtggcgacacacgcttgacatggtgctcgcaagggctgcgggtctg
cttcgcacagaggttcgatccggcctcatgtttgactgtctgtcagaattgcttccgcgc
atttcgacgccttcgaccgacgctggcgctctggatgcgccatctgccgacctcgtcgct
ggcgccgtgctctcgctgcttacgtcgctgcgacagcatcgtgtcgagttgacgacaggg
gcactcgacctcgagacagtcgatgctcttcccacggaccgactgctcacgacgctgcgg
gccctcatcgactcgattctgagacttgagaccacaacactggctcgcggcaacctctac
tcggccctgatcaacttccttcagctggtcaagtctggaagcggcgccgatgccagcgat
gagactggcgccaatgatggtgcttcgattgtggcgaccgacgttgacgataccatgtcc
gtgggcggtgcctcgacgaccatcaccaacatttttggcggacgcacgcagacgagcagc
ctggaggcgcgcactcgaaccctgctgctttcgtatcttgaacgtctgatggatgtgctg
ggtcgcgatgcgctggatgccagcgatctgtccaagacaattgctttcacgctgctcgac
aagctgtgtgcgctcgatgcgccgccttcatctggctcctcgtcccgtcgcggcggatcg
aggtgccttgatctgctggaccgcaagggctacattaaaagctttgtcacagcgctgcgt
gattcggacctggctttgcaagagactctgcgtcccgaccctgccagcctgaactcactc
tacgtctacgaagcacgtctcgccttcttcaaccgcatggcccagtctcgcgacggtgct
gagcgcctacttaacgccaagatctttgacgtgcttgcgcagtccgactacctggcagca
cgccccgatcaagatcaagaatttgtcgattttgacagcttcctgcctgcagctacggag
cgttacaatgcgatgctgacaccggtgctccagctgacgacgagtatcctcgccagtact
tcggcaggagcagcgagccaaggagctttcggcattaccaaggcattgtcatccacctcg
gcatcttcagctcctcgtcatgctttggcgctcttgaccgcgcaccgagacacgctcctc
accgtcctccgcgcgcctctgcaagagttctgctcgtttgcccagcttggtcaagctcat
ctggtggtcgccatctttgtgctgatcatgtcctcgctcgacgacgacgcgcaacaggcg
cctagcccgcttgctccctaccacactgccatcgttgcctttgctgccgtctacctgaac
acgatgtcgtggcagtcacgcgtcgtaccctgcaatgaggccgagcgcgaagaaagccat
gtgccgactgcctcgttgcgtgcgctgcgagcttcgagcgagggagcacacggcaatggc
agcgttggagcagaggaagaaaacgcgttcagcgccaaggtaagcgcgatggtggtacga
ctgcagatggcgttgctctcttatctcgaggcagcgagcgatgctcgaggcagtaacact
gtgcgagttcgaccagtggtagcggcatcgctgacggcgaatcgcgagcgatcgcgtacg
ccttacggggcaggtgaggatggcggcgatggcgacacttctcgtgctggttttctgcgc
tcgcaacgcgcgtctgctgctgcgttgacagtgcccagcatcggtggacttgtcgcagcg
ctcgacgaatacacggattcggtggccaaagagcttcaagcgctggagaacatcgagacg
ctcttcgagaatgttgacagtgtacgtcaggacgagttggacgagattgctcgcgatgcg
ctcgaccaagtgactgcaggcgagctctccgcggctcaacgtcgatctgtggcgctccgc
cagctctcatcgcgcaaagccacgctccgcgcatcgtcaacgtccaaacttgatgcgctc
gagctgattctcgtactgcttattcgtcacattgaattcttccgaacgctccacgctgat
cgagtatccatcctcacctcggtcggaaccaggtcttcgcctgctgctctgcaaggcgct
gcatcccacttagactggaacagcttgatgcacggtcttgctgaatctttgctacctgtg
gtcgacgaaaagatcggctacctctcgcttccaccaagcttggtagccaatgcaagagag
agacagagcttccttcagatggctggtcgacgactggctagcttctttaccgagcaatag

DBGET integrated database retrieval system