KEGG   Ustilago maydis: UM02567.1Help
Entry
UM02567.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UM02567.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 448 aa AA seqDB search
MKDSWSSNSTTSTAIRLVGSPYGTDSPFQPTFTYPIYGEAETIYGYEGLAIKLSVASGSL
VPLLEVTYRAKNEATTAEIDDVEGKIKEFLAPDFLSTSSPSAMEEFETVVKADKEFRPLG
DKVHSYTRGKVDKGKAKSSTASLASSTLSASDPNARVFEIYRSTWHTPGFREYHRRMQLF
TLLFIEGASYIQEDETNWEFFTLYEKVSRDDKQTWHFMGYTSLYKFWCWPDSSRIRLSQF
VILPPFQKQGHGGALYTTVYDQIRERANVTELTVEDPSEDFDRLRDGNDLRRLLAPGGFA
DSAKAQNKLHAPLDKEWIESQRLQHKLAPRQWSRVLEMVQLMNLDTTDHEQVKQYRLQVK
ARIYRQNKDILMQLEKQQQRSKLQETFEGVVEEYGDMVGVDVEDLLDDGPSGTGALYGAD
EEEDQEQGQGDRHYSNGNGPPRKMARLA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcttggtcctccaacagcaccacttccacagctatacgccttgttggctca
ccgtacggaaccgactctcccttccaaccaactttcacctatccgatctatggcgaggcc
gaaactatctacggttatgagggactagctatcaagctgagcgtcgcatcaggcagcctc
gtgccgttgcttgaagtcacataccgcgcaaagaacgaagctaccacggccgaaatcgac
gatgtcgagggaaagatcaaggaattccttgcacctgatttcctttccacctccagccct
tctgcgatggaagagtttgaaacagtggtaaaggcggacaaagaatttcgaccgttgggc
gacaaagtgcacagctacacgcgtggcaaagtagacaaaggcaaagccaaatcgagcaca
gcatcgctcgcctcttccaccctatccgcaagtgacccgaacgcaagagtgttcgaaatc
taccgatccacctggcatacacctggattccgcgagtatcaccgtcgaatgcaactattt
acactgctctttatcgaaggtgcgagctacattcaggaggacgagactaattgggagttt
ttcacgctctacgagaaagtctcgcgcgacgacaagcagacatggcactttatgggctat
acatcactctacaagttctggtgttggcccgattcgtctaggatccggttgagccagttt
gtcattctaccgccattccaaaagcaaggtcatggaggagcgctctacactacagtgtat
gatcagattcgagagcgcgccaacgtgaccgagctcacggtggaggatccatcagaagat
tttgatcggttgcgggacggaaatgatctgcgcaggttgttggctccaggtggatttgcg
gattccgcgaaagcgcaaaacaaacttcatgcgccattggacaaagaatggatcgagtcg
caacgactgcaacacaaattggccccacgtcagtggtcgagagtgctcgaaatggtgcag
ctgatgaacctggatactacggatcatgagcaggtcaagcagtacaggcttcaggtaaaa
gcgaggatctaccgccagaacaaagacattctgatgcaactggaaaagcagcaacagaga
agcaagttgcaagaaacctttgagggtgtggtggaggagtatggtgacatggtgggcgta
gatgttgaggatctgctggatgatggaccgagcggcacaggtgcgctgtacggcgcagat
gaggaggaggatcaagagcaagggcaaggggacaggcactatagcaacgggaacggtccg
ccgcgcaagatggctcgcctcgcatga

DBGET integrated database retrieval system