KEGG   Ustilago maydis: UM02579.1Help
Entry
UM02579.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
uma  Ustilago maydis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    UM02579.1
   03420 Nucleotide excision repair
    UM02579.1
   03430 Mismatch repair
    UM02579.1
   03440 Homologous recombination
    UM02579.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6
AA seq 285 aa AA seqDB search
MFNNGFGGESNPYAQNYSTGGGASGGGFLANGSQNDSPSGKKAGNNTLRPVTIRQILNAE
QPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDDSSK
ASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQATRGPTAS
ALKGATSTALFNQAGGLESNDMNAYSGSKKQDVNDLYKNLGELPQQIMSIVTRESQNHPD
GVHVSLIARLLNGVDVNDVKSAVEDLSSDGYLYTAADDNHVLPTA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaacggctttggaggagagagcaacccatacgctcagaactattcaacagga
ggaggcgcgagcggaggcggcttcttggccaacggaagtcagaacgactcgccaagcgga
aagaaagcaggcaacaacacgctccgacccgtcactatcaggcagatcctcaacgctgag
cagccgcacccagacgccgagttcattcttgatggtgccgagctgggtcaattgaccttt
gtcgctgtggtcagaaacatctcgaggaacgctaccaacgttgcatatagcgtcgaagat
ggaactggacagatcgaagtgcgtcagtggctcgacagctctagtgatgatagctccaag
gcgtccgaaattcgcaacaacgtctatgtacgagtgctcggtacgctcaagtcattccaa
aaccgacgttccatctcgtctggtcacatgcgacccgtgatcgactacaacgaagtcatg
tttcaccgactcgaagcagtccacgcgcaccttcaggcgacacgtggtcctacagcatct
gcgctcaagggcgccacttccactgcgctattcaaccaagccggaggcttggagagcaat
gacatgaacgcctattcgggaagcaaaaagcaagacgtcaacgatctgtacaagaacctc
ggcgaactgccacaacagatcatgagcatcgttacgcgcgaatcgcagaaccacccggat
ggcgtccacgtcagcctcattgctaggttgctgaacggcgtagatgtgaatgacgtcaag
agtgccgtggaggacctgagttcggatgggtatctgtatactgcggctgatgacaatcat
gtgctgcccactgcgtag

DBGET integrated database retrieval system