KEGG   Ustilago maydis: UM02708.1Help
Entry
UM02708.1         CDS       T01021                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
uma  Ustilago maydis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    UM02708.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 108 aa AA seqDB search
MGFKDGDSKKGAGLFKTRCAQCHTLGAGEPNKVGPNLHGLFGRKTGSVDGFSYTQANINK
GVTWDEETLFEYLENPKKYIPGTKMAFAGLKKDKDRNDLITYLREETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaaggacggtgacagcaagaagggcgctggtctcttcaagacccgatgtgct
cagtgccacaccctcggtgctggtgagcccaacaaggtcggccccaacctccacggtctt
ttcggtcgcaagaccggtagcgtcgacggtttctcgtacacccaggccaacatcaataag
ggtgtcacctgggacgaagagactctctttgagtacctcgagaacccaaaaaagtacatt
ccgggtaccaagatggcctttgctggtctcaagaaggacaaggaccgcaatgatttgatc
acgtaccttagggaagagacaaagtga

DBGET integrated database retrieval system