KEGG   Ustilago maydis: UM02790.1Help
Entry
UM02790.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:uma01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:uma00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:uma00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:uma00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 369 aa AA seqDB search
MVQDPRETQLEVTPTNRVAIFYENGGPDKISIKQLDNIKPSELNAGEVLVRVLFTGVCHS
DLHALQGDWPFPPKLPLIGGHEGAGVVVALGAGSQEYVQIGDRVGIKWIADACLNCEYCR
LSHEINCAQYKSSGCECGSALKLVGFERDKYVRHTARYLTKIPDALDLAQAASILCAGVT
IYRALKEAHLEAGNWVVIPGSGGGLGHLGVQYALNAGLRVIGIDTGSDKQHMSLSLGCEV
FVDFKTSDVATAIKAATGGIGAHAAVVAAASSAAYELALDYIRPRGTLVIVGMPNSILPL
SIFKTVLMTHKIVGSAVGNRQDAVEALDIASRGKVKVHFTMKGLTDLPHVFQDMIHGRIA
GRIVLDVDK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagatccgcgcgagacgcagctcgaggtgacgccaaccaaccgcgtagccatt
ttttatgaaaacggtgggccggacaagatctcgatcaagcagctggacaacatcaagcca
tccgagctgaacgctggagaagtgcttgttcgggtgctgttcacgggcgtctgccactcg
gacctgcacgccttgcaaggcgactggcctttcccacccaagcttccgctgattggcggt
catgagggagccggagttgttgttgctctaggagctggatcgcaggaatacgtgcagatc
ggcgaccgcgttgggatcaagtggatcgccgatgcatgcctcaactgcgaatactgtcgc
ttatcgcacgagatcaactgtgcacagtacaagtcaagtggatgtgagtgtggatcggcg
ttgaagctcgtcggtttcgagcgagacaaatacgttcgacacacggctcgatacctaacc
aagattccggacgcgctggacctcgcacaggcggcgtcgatcctgtgtgctggagtgacg
atctaccgtgcgctcaaggaggcgcaccttgaagcgggcaactgggtcgtgattcccgga
tcgggtggagggttaggccacttgggcgtgcagtatgcgctcaatgccggactgcgcgtg
attgggattgatacggggagtgacaagcagcacatgtcgctctcgctcggatgcgaagtg
tttgtcgatttcaaaacctcggacgtggccacggcgatcaaagcggccacgggaggaatt
ggtgcgcacgcagctgtggtggcagcagctagctcagctgcttacgagcttgccttggac
tacatccgccccaggggcacactagtgattgtcggaatgcccaactcgatcttgcctctc
tcgatcttcaagacagtgctaatgacgcacaaaatcgtcggctccgccgtaggcaaccgg
caagacgccgtcgaggcgctcgacatcgcttccagaggaaaggtcaaggtgcactttacc
atgaagggcctcaccgatctaccgcatgtcttccaggacatgatccacggtcgcattgct
ggaagaatcgtcttggacgtcgacaagtga

DBGET integrated database retrieval system