KEGG   Ustilago maydis: UM02911.1Help
Entry
UM02911.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1453 aa AA seqDB search
MGAQRSESDLNSIVDNVTRPNDATNHIRNGVGVASPAADDGETIDITIDEDDHKKVFGSQ
SSVCLELPPHPIVRPRTEYEPQTTPSISHNLPASPPPSYDDASMPLTDAALPDASSVATP
HIAHLLLPTALHDSGLLFNPQLSQSRVSLERDPIPEAPSATISKADSLVPASISPLTDCA
LIPTLAQCESCKPHPDALFVAETLEWRLILDRSCMYRLPPAPSSQYDATDLYEACDLVPG
SVPMYETQPTIIPAHDQCRAVQLLQHWDPATPDAPLPFLEEFNTHFCPFTGKHIFSSPPD
SIVTVVDRHLLIRFKESRENDPAVGLTGLESFLRALRILLRVVGNYVHGERRGVPTTSAS
LTQKLGWDRHSRQFFLSLGWKESTMADGRNAIVPPSTSTDLFDANFHLQRNIRAWIELSI
WHTFHVEQLRKTRPNSPVLTSPDKFAVATRVQIHPAAESLLDLIGSRQDHLDPTYKTTLS
PATLEAFFTLGASSTARDQLVKFAYLVNMKAGHGHTALNLFAALNQVYTSQRRTSRVLEE
LIAYERSQGRYTPRDIDQAYERLHLSTAHLGPDVERLSIPHSLIVDNYKARVREVLINSD
ASEHAALKDALRIIAVDLGKPERLIKALDEDIDMDIDQACSMLDTNPDMDDSTVLAIFDL
YVADAPARQDALRHALRAIAEHRNSDYLRHFLRTGQKDASVAETWQQMPSNDLPAGIDNI
GNTCYLNSVLQYFFSITEVRDRVLQAAASLAESTATAQLSCDTERRVGGQRITARELQRS
RRFVAQLGGLFHHLIHANALSVRPERDLAYLALVSSRAEDFEKELDPVPETGALLQHQGD
VVAYSSDPSVLSSEPVTIGNASLDAGINTVSAAVDGESMELTADELSARQMDPLQAHASN
TSTSAPPLPPRPARQSTSADSTSAALPPPARRNSLMQLGAQQDVSECLDNCMFQLEVALA
ASEAAFAPRTSTEQTIVVDGSEESKAVSDTVNGSDQEDLLTSLFLGKTCQRIEADTKPTI
GNNADGSLSRPAQPQKQPSTHIKHEVFKILPIDVLEEGRDIYDGFDGFFDSDTFVSTSGA
VQRRSVTLLSAPPLLQIQLQRVQYDRVTMRTFKSQAHLDMPETLYVDRYMDVSADDPENA
VRIAKRLDYQAKRKRIEELRAKLAACKDGSNVHLTQTLSQAANAVEELARLPPLADVAAQ
LDEIEKQSAQPEAIEQDSSSRRCLAKQSAEDTSASTESNATHSATADSTAPGTVDSAYPQ
SLSSVIDAGLATLLRDESKLVREQVKQAQEEIDTLKSEMASIWADERRFAYRLVAAFMHR
GEASHGHYFLNLRGGGENGKWFKYNDSTVSETSLDQVLRDRSGATPYLVTYVREDYVHLI
DPICRAIEHQNRAMDVDQEKHVHEALNGVNHTKANVDEGCAVHNDEAARTVDVAEQAPSG
PESPVKRARTDDL
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgcagcgaagcgagtccgatctgaacagcatagtagacaatgtcacacgaccc
aacgatgccacgaaccatatccgcaatggtgtcggtgtagcttcgcctgctgccgatgac
ggcgaaaccatcgacatcaccatcgatgaggacgaccacaagaaggtgtttggctctcag
tcatcagtctgcctcgagctcccgcctcatccaatagtccgtccacgcacagagtacgag
ccacagaccacaccgtccatctcgcacaatcttcctgcttctccacctccgtcgtatgac
gatgcctcgatgccactgacagatgctgccttgcccgacgcaagttcggttgcaactcct
catattgcccacctgctgctacccaccgcactccacgattccggcctgctctttaatccg
cagctcagccagagcagagtcagcctcgagcgtgatcccatcccagaggcaccctcggcc
acaatctcgaaagcggattccctcgtacctgcatccatatctccacttaccgattgcgct
ctcatacccaccctcgcacaatgcgaatcttgcaagccacaccccgatgctctctttgtc
gccgagacgctcgagtggagactcatcttggatcgttcctgcatgtaccgcctaccaccc
gctccgagctctcagtacgatgcgaccgacctgtacgaagcctgcgatctggtgccaggc
tctgtccccatgtacgagacccagcccaccatcattccagcccacgaccagtgcagagct
gtgcaacttctccaacactgggatccagccactccagatgcgcctcttcccttcctagaa
gagttcaacacccacttctgcccttttactggaaagcatattttctccagtccaccagac
agcatcgtcactgttgtcgaccgtcatttgctcatccgcttcaaagagagtcgcgaaaat
gatccagccgtcggtctcacagggctagagtccttcctccgtgcgcttcgcatcctactc
agggtggttggcaactacgttcatggcgaacggcgcggcgtaccaaccaccagcgcttcg
ctcactcaaaagctcggatgggatcggcactcgcgacagttctttctcagccttggctgg
aaggagagcaccatggccgacggccgcaacgccatcgtgccaccttcgacctcgaccgac
ctattcgacgcaaactttcacctccaacgcaacatccgtgcttggattgaactcagcata
tggcacactttccatgttgaacagctacgcaaaacaaggcccaattctcccgtccttacc
tcacccgacaagttcgccgtcgccacacgcgtccaaattcatcccgctgccgagtcactc
ctcgacttgatcggatcgcgtcaggatcacctcgatcccacctacaaaacaaccctctct
cccgccacgctcgaggctttcttcactctgggcgcgtctagcaccgctcgcgaccagctc
gtcaaattcgcctacctggtcaacatgaaggctggccacggtcacacagccctcaacctc
tttgccgcgctgaatcaagtctacacgtctcagcgccgcacgtcgcgcgtgctcgaggag
ttgatcgcatacgaacgaagccaagggcgctacactccccgtgacatcgaccaagcatat
gagcgacttcatctgtcgactgcccatctcggtccagacgtggagcgcctgagcattcct
cacagtctcatcgtagacaattacaaagcgcgagtacgcgaggtgctgatcaacagcgat
gcatcggagcatgctgccctcaaggacgcgctccgtatcatcgccgtggacctcggcaag
cccgaaaggctaatcaaggcgctcgacgaagacatcgatatggacattgatcaggcgtgc
agcatgctcgacaccaatcccgacatggacgactcgaccgtcttggccatctttgacctt
tacgtagctgacgctcccgcccgtcaagacgctttgcgtcatgctcttcgcgccattgcc
gagcatcgcaacagcgactatctgcgtcactttttgcgcacgggtcagaaggatgcgtcg
gtcgccgaaacctggcagcaaatgccttcgaacgatcttcccgccggtatcgacaacatc
ggtaacacgtgctatctcaactcggtgctgcagtactttttctccatcactgaagtacgc
gatcgtgttttgcaagctgcagcttccctcgccgaatccacggcgacagctcagctctcg
tgcgacaccgagcggagggtaggcggtcagcgcatcacggctcgcgaactgcaacgcagc
agaagatttgtggctcagctcggcgggctctttcatcacctcattcacgctaatgcgctt
tccgttcgtcccgagagggatctggcatatctggcgctggtctcgtcgcgcgcagaggat
tttgagaaggagcttgaccctgtcccagagacgggcgcactgctgcaacatcaaggagac
gtcgtcgcttatagttcagacccatctgtcctttcgtcggagccagtcacgatcggaaat
gcaagcttagacgcaggcatcaacacagtttccgcagctgttgatggcgagtcgatggag
cttacggcggacgagctgtctgcaaggcaaatggatcctttgcaagcacatgcatcgaac
acatctacatcggctccgcccttaccgcctagacccgctcggcagtcaacgagtgctgat
tcgacatcagccgccctgccaccgcctgcgcgacgtaactcgctcatgcagctgggtgcg
caacaggacgtttccgaatgcttggacaactgcatgtttcagcttgaagttgctttggct
gcgagcgaggctgcattcgccccaagaacttccaccgagcagactatagttgtggatggg
agtgaagaatccaaggcggtgtccgacacggtcaacgggagtgaccaagaagatctgctc
acaagcctcttcctcggcaaaacatgccaacgcattgaagcagataccaaaccgaccatt
ggcaacaacgctgacggttcgttgtcccgaccagctcagccgcaaaaacagcccagcact
cacattaagcatgaggtgtttaaaatcttgcccatcgacgttctcgaggaagggcgcgac
atttacgatggctttgatgggtttttcgactcggacacttttgtttccacgtccggcgct
gtgcagcgtcggtccgtgacgctattgtcggctccaccactgttgcagatccagctgcaa
cgtgtgcagtacgaccgcgttacgatgcggacgttcaaatcgcaggcgcacctcgacatg
cccgagacgctgtacgtcgaccgatacatggacgtgtccgcggatgatccggagaatgca
gtgcgtatcgccaagaggctggattaccaagccaaacgcaaacggatcgaagagttgaga
gcgaagctagcggcgtgcaaggacggttccaatgttcacttaacgcagacactcagccaa
gcggcgaacgcggtggaggagctggcaaggttgcctcctttggccgatgtggccgcgcag
ctggacgagatcgagaagcaaagcgctcagcctgaggcgatcgagcaggattcttcgtct
cgcaggtgtttggcgaagcagtctgctgaggatacgagtgccagcacagaaagcaatgct
actcactcagcaactgcggatagcaccgctcctggcactgtcgacagcgcgtatcctcag
tctctttcaagtgtcattgatgcaggacttgctacactgctccgagacgagtcgaagctc
gtacgtgagcaagtcaagcaagcgcaagaagagattgatacgctcaagtccgagatggcg
tcgatctgggcggacgaacgacggtttgcctaccggctggtggcagccttcatgcatcgc
ggcgaagcgagtcatggacactactttttgaatctgcgcggtggtggcgaaaacggcaag
tggttcaagtacaatgactcgacggtgagcgagacatcattagaccaggtgttgcgcgat
cgatcaggtgctacgccgtacttggtgacgtatgtacgcgaggattatgtgcacctcatc
gacccgatctgcagagcgattgagcaccagaaccgcgccatggacgtggatcaggagaag
cacgttcacgaggcgctgaatggggtcaaccacaccaaggccaacgtggatgaagggtgt
gcagttcacaatgacgaggctgcgcggactgtcgatgtggcagagcaagcaccgagtggt
cctgaaagtccagtcaaacgcgctcgcacagacgacctttag

DBGET integrated database retrieval system