KEGG   Ustilago maydis: UM02982.1Help
Entry
UM02982.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
uma  Ustilago maydis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    UM02982.1
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    UM02982.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     UM02982.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1491 aa AA seqDB search
MSASDRHAASDRAAGRSVRSWLRSLLQGPSDQHADRGTYASSQGSAVVSSTGPASVGTDM
ISFHHTFEDVERPSFAPPPRSFSGGSSNGSLSYDAAAKRTLAQPIATPRAGAAHSSTNLL
SANSLATSPSPSASPPKSPRIARTLTSSVASLTDRLHHQRRASETYRRMRSGSTSAEVDS
QQIVLSRSLSKTLDRDSPLLASPSAISENEPVSSPPPTHLSHDSQLSPTGSLANPSDSNR
YGPETSGVRRSDSSGTTTAIGESLSPSQSSAGAAPSTCEASHELLLPEGEQMLKVTHKKV
KPRTFKLDPDRGQILWESKKNNRVNLESIREVRFGPSAASYRTSLNISSAHESRWLTIIY
QNNGIYKALHLIALSDQSLSRWRASLLHLQSLRRELLGAVGASSSLENRRHLWMRHHWKD
ADESNDEKLSIEEVILLCRRLGIESNKAHLRRCFNLADWRNRGFLDFQDFQHFVSLLKQR
ADIETIFAAWADQPLEQPLEQLRRGSGVTKDDHDLRGQAPELEGSPALSDASSVDTQSCP
APSVMQTSRVMGPEPCRTQAMSIDSFRRFIREEQGNHNFSNGQIDDLFHRHCNSRLSSSH
HADAPTERAQMDYDGFLDFLSSSDNPPLLDQLPLFSTIVSNPVDATVLGRPPCSGSIDAV
EYSDTQQCSQQQDTDANQCPQQRTPSRAFANTTDELIAAGASDSMANTRKVAAHLRKSTI
QHDMTRPLSEYYISSSHNTYLVGGQWKGDSTVEGYIRALLQGARSVELDCWDGPNNVPQI
THGRTLTSRVPFQDVISAIARYAFVTSPYPLILSLEVHADPPQQEVMARILIDTLGEMLL
SQPIDSQTLPGSTDELPSPEKLKFKVLVKAKNVAAADGHQALPLPKAADGLALSAKQKDG
TDVIPTMVLEPPTSATDTTSTTDSEIESRLTSAKQLVCRVTRRSHRVQATSAGQAGYRSG
DASDDGTAKASYETPGNGSRSSKATKKMMSTALASLLIYTIGVKCRGFNKKESYATQHMV
SLSEKTALKMIRDPISNEALIKHNRSHLTRIYPSMMSFARLHASRNFVPLDMWAAGCQLV
ALNWQTTDLGFELNQAMFSRNGRCGYVLKPAALRTKEHGKTLQGKVVRFQLDLRIVSAQQ
LPKKNKAGASKDKDKDKGHSYHDNREPIDPFVVVSLLTPGCWGKQPKGLLQKASTPREAK
ELPLSPAPPVDHCEAAPDSVIQTRQTSVSEQSSGDGTIAAASSHTDKRLQHSADVGSSSE
PSPGPQRAKSSAKTTALAPTHLLRTPTVKGNGFSPEWHTHMSVLIDVPAGASNELAALVE
ASKASQGAALTYPELERLSRGLLDLCFVRFEVFDDDLDDDVAEEQATSRTTRGSEDTLAP
TPSISTAVVESGSRLSLNPTAAIRQSNTEAAADDDAGSKAGSETSSTSSTSSIDAESVAA
YSVSVGALQQGYRHLPLYDHQLSQFLFSTLFVHSRLRLVGLVDGVAPGKQS
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagcgatcgtcatgccgcctctgatagagctgctggtcgttcggtgcgctca
tggctccgatccttgcttcagggaccatcggatcaacatgcagatcggggaacctatgcc
tcctcacaaggctccgcagtcgtctcatccactgggccagcctcagtcggcacggatatg
atctccttccatcatacattcgaagacgtagagcgtccaagctttgctcctccgccaaga
tctttcagtggtggctccagcaacggctcgctctcctacgatgcggctgccaagaggaca
ttggcacagcccattgcgacaccccgtgccggtgcagcacacagctcaacgaacctgttg
tccgccaacagtctagccacgtcaccaagtcccagtgcatcaccacccaagagccctcgc
atagcacgcacactgacgagtagtgttgcctctctcactgatcggttgcatcaccaacgg
cgtgccagcgagacatatcgcaggatgagatccggcagcacgtcggcagaagtggattca
cagcagatcgtactttctcgcagcttgtctaaaaccttggacagagattcaccattgcta
gcgtctccttctgcgatctcggaaaatgagccggtctcctcacctcctccaactcatttg
agtcacgacagtcaactatccccgacaggatccttagctaacccttccgatagcaatcga
tacggccccgagacctcaggtgtccgacgatccgattccagtggcactacaactgcaatc
ggggaaagtctttcgccatcgcaaagctctgctggtgcagctccatcgacttgtgaggca
agtcacgaattgctgcttcctgaaggcgaacagatgctcaaggtcactcacaaaaaggtc
aagccacgcacctttaagctcgatccagatcgcggccagattctgtgggaatcaaagaaa
aacaatcgcgtcaatctcgaatcgatccgcgaagtccgttttgggccctctgctgcctcg
tatcgcacatccctcaacatctcttcggcacacgagtcgcgctggcttaccattatctac
cagaataatggcatctacaaagcccttcacctcattgccctttccgatcaatcgctctcg
agatggcgagccagtctgctccatctccaatctctgcgaagagagcttctcggcgcagtt
ggcgcttcctcgagccttgaaaatcgccgtcacctctggatgcgccatcactggaaagat
gcagacgagtccaacgatgagaagctttccatcgaagaagtcatactgctttgtcgacgt
ctaggtatcgagtccaacaaggctcaccttcgacgctgcttcaaccttgccgactggcgc
aatcgcggctttctcgattttcaagactttcagcactttgtctcgctgctcaagcagaga
gccgacattgagaccatctttgctgcctgggcggaccagcctctggaacagcctctggaa
cagcttcgacgagggtctggcgtaactaaggatgaccacgaccttcgaggacaggcacct
gagctcgagggttctccggccctgtcagacgcatcaagcgtcgatacccaatcttgccct
gccccttcggtcatgcaaactagccgggtgatggggcctgagccgtgtagaacccaagct
atgtcgatagacagtttccggcgcttcattcgtgaagagcaaggcaatcacaacttttct
aacggtcagattgacgatctcttccaccggcactgcaacagtcgcctttcaagctcgcat
cacgccgatgcccctaccgaaagggcccagatggactacgatggctttcttgattttctt
tcttcatctgacaatccacccttgctagaccagcttccactcttttcgaccattgtttcg
aaccctgtcgatgcgactgtgctgggcagacctccatgttcgggctcgatagacgcagtc
gagtatagtgacacacagcagtgttcgcagcagcaagacacagacgccaatcagtgccca
cagcaacgcacaccttcgcgtgcttttgccaatacaactgacgagctgatcgctgcaggg
gcaagcgattcgatggcaaacacgagaaaggtggccgcccatctacgcaagtcgaccatc
cagcacgacatgacgcgtcctttgagcgagtactacatcagctcgagccacaatacttat
ctcgtcggaggacagtggaaaggagacagtaccgtcgagggttacatccgcgctcttctg
caaggcgcacgtagcgtcgagctcgactgctgggatggtcctaacaacgtgccgcagatc
acccatgggcgtaccctcaccagccgggtgccctttcaggacgtcatcagcgctattgct
cgctacgcctttgtcacgtcaccttatcctctcatcctcagtctcgaggtacatgccgac
ccaccgcagcaagaggtcatggcacgtatcctcatagatacgcttggtgaaatgctcttg
agccagccgattgactctcagactttgcccggctcgactgacgagcttccttcgcctgag
aagctcaagttcaaggtattggtcaaagcgaaaaatgttgcagcggctgatggtcaccaa
gcgctcccccttccaaaggcggccgatggcttggctttgtctgctaagcagaaagacggc
accgatgtgattcccaccatggtgctcgagccgccaacgtctgcaacagataccaccagc
acgaccgactctgagattgaatcgcgtctcaccagcgctaagcagctcgtttgccgcgtc
accaggcgcagtcatcgagtccaagcgacatcggcaggtcaagcaggatatcgttccggt
gatgcatccgatgatggcactgctaaagcaagttacgaaaccccaggtaatggcagtcga
agcagcaaagcaacgaaaaaaatgatgtcgaccgcgctcgcttcactgctcatttataca
atcggcgtcaaatgtcgcggtttcaacaagaaggagtcttatgctactcagcatatggtc
tccttgtcggagaagactgccctcaagatgatccgcgatcccatttccaatgaggcactc
atcaagcacaaccgctcccatcttacgcgtatctacccctcgatgatgagctttgcgaga
ctgcacgccagtcgaaactttgttccgcttgacatgtgggcagccggatgtcagcttgtg
gcgctcaactggcagacgactgatttaggctttgagctcaatcaggccatgttcagccgc
aacggccgatgcggatacgtgctcaagccagcagcgctacgcaccaaagagcacggcaaa
acgcttcagggaaaagtggtgcgctttcaactcgatcttcgcattgtatcggcgcagcag
ttgccaaagaagaataaagctggtgcgagcaaggacaaagacaaggacaaggggcatagc
taccacgacaaccgcgagccgattgacccgtttgtggtagtctccttgctgacgcctggt
tgctggggcaagcaacccaaggggctattgcagaaagcgtcgacgccgagagaggcgaag
gaattgcccttgtcaccagctccgcccgtagatcactgcgaagcggcccctgacagcgta
atacagacccggcaaacaagcgtttctgaacagagttcaggcgatggcaccattgcagca
gcttcaagccatacagataagcgcctccagcattcagccgacgttggttcctcctctgaa
ccctcgccagggccacagagagctaagtcatcggcaaagacgacagccttagcgccgact
caccttcttcgcactccaacggtgaagggcaatggctttagtccggagtggcatacacac
atgagcgtgctcatcgacgttcccgccggggccagtaatgagcttgctgcgctggtcgaa
gccagcaaggcctctcaaggcgctgccttgacgtatccggagctggaacgcctaagtcgt
ggtcttttagacctctgctttgtgcgctttgaggtttttgacgatgacttggacgatgac
gttgctgaagaacaggctacatcaaggacaacacgaggttctgaagacacactggctccg
accccatcgatctcgactgccgtcgtcgaatctggctctcgactctctttgaacccaacg
gcagcgattcgacaaagcaacaccgaagctgctgcggatgacgacgctggaagcaaggcg
ggtagtgaaacctcgtctacatcatccacatcgtcgatcgacgctgagagtgtagcagct
tattcagtatcggtgggtgctctacaacagggctaccgtcatctaccgctgtacgaccat
cagctctcgcagttcctgttctcgaccctgttcgttcattcaaggttgcgtctggttgga
ctcgttgatggcgttgcacctggtaagcagtcatga

DBGET integrated database retrieval system