KEGG   Ustilago maydis: UM03069.1Help
Entry
UM03069.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM03069.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM03069.1
   00620 Pyruvate metabolism
    UM03069.1
   00640 Propanoate metabolism
    UM03069.1
  Energy metabolism
   00680 Methane metabolism
    UM03069.1
Enzymes [BR:uma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UM03069.1
Lipid biosynthesis proteins [BR:uma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UM03069.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 664 aa AA seqDB search
MVEADVPEVPTYDVPSRLLGKDGRPVPHVDAAKYKAEYPDSINNTDEFFGKVAKEIIDWD
VPFKTVRSGGFENGDVAWFNEGRLNAAYNCVDRWAHKYPDRVAIIYEADEPGQHQEITYS
QLLIQVSQAANMLKSLGVKKGDTVIVYLPMIPEAAVALLACARIGAIHSVVFAGFSADSL
RDRTNDCGARVVITTDEGKRGGRTIATKSIVDAALKECPGVEHVVVVKRTGGQINIDDKR
DIWWHEACSRERAFCPPESVSSEDPLFILYTSGSTGKPKGVVHATAGYLLGTALTLRHVF
DVHPDKGDRFACMADVGWITGHSYIVYGPLMNGVTTLIFESTPVYPSPSRYWEIVDTHKL
TQFYTAPTSIRLLRRLGDEHVKKHDLSSLRVIGSVGEPINPEAWHWYNDNVGRQQCAIVD
TYWMTESGSIMITPLPGATKTKPGSATLPFWGIKPVLLDPTSGNVLEGNNVEGVLAIAQP
WPSVARTVYNDHQRFLDTYMRAYKGYFFTGDGAARDKDGYIWIKGRVDDVINVSGHRLST
AEIESALIQHPGVAETAVVGIPDEVTGQTIAAYVTLKPEFSYDSEDALTKELVIQVRRNI
GPFAAPKKIIIVSDLPKTRSGKIMRRLLRKCASHDTDNLGDLSSLADPSVIEHIKEKTNA
FDKK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagccgacgttcccgaggttccaacctacgacgtcccttcccgtctgttggga
aaggacggccgtcccgttcctcacgtcgatgccgccaagtacaaggccgagtatcccgac
tcgatcaacaacaccgacgaattcttcggcaaggtcgccaaggagataattgactgggat
gtacccttcaagacagtacgatccggtggcttcgagaacggcgacgtcgcctggttcaac
gagggccgtctcaatgcagcctacaactgcgttgaccgatgggctcacaagtaccctgat
cgtgtcgccatcatctacgaagccgacgagcctggtcagcaccaggagatcacctactcg
cagctcctcatccaggtctcgcaggctgccaacatgctcaagtcgcttggcgttaagaag
ggtgacacagtcattgtctacctccccatgattcccgaagccgctgttgcgctcctcgcc
tgtgctcgtatcggtgccatccactcggttgtctttgccggtttctctgccgactcgctg
cgcgatcgtaccaacgattgtggcgctcgcgtcgtcatcacaaccgacgagggcaagcgt
ggtggtcgtaccatcgccacaaagagcatcgtagatgctgcgctgaaagagtgccccggc
gttgaacacgttgttgtagtcaagcgcacgggaggtcaaatcaacattgacgacaagcgc
gacatttggtggcacgaggcgtgctcgcgtgagcgtgccttttgccctcccgaatcggtc
agctcggaggacccgctgtttatcctctacacttcgggctcaacgggtaagcccaagggt
gttgtgcacgctaccgcgggatacctgctgggtaccgcgctgacactccgacacgtgttc
gatgtgcacccggacaagggtgatcgcttcgcctgcatggccgatgtcggctggatcacg
ggccactcgtacatcgtctacggtccgctcatgaacggtgttacgacgctcattttcgag
tcgacgccggtctacccttcgccctcgcgttattgggagattgttgacacgcacaagctc
acccagttctacacggcacccacctcgatccgtctactgcgacgactgggagacgagcac
gtcaagaagcacgacctctcttcgctccgtgtcattggctcagtcggtgaacctatcaac
ccggaagcgtggcactggtacaacgacaatgtcggccgtcagcagtgtgctattgtcgat
acctactggatgaccgagtctggttcgatcatgatcacgcccttgcccggtgcgaccaag
accaagcctggatcggctacattgcccttctggggcatcaagcctgtgctgctcgaccct
acttcgggtaacgtgctcgagggcaataatgttgaaggtgtgcttgccatcgctcagccc
tggccttcggttgctcgaacagtgtataacgatcaccagcgattcctggatacatacatg
cgtgcctacaagggctacttctttaccggtgatggcgctgctcgtgacaaggacgggtac
atctggatcaagggtcgtgtcgatgacgtcatcaacgtctctggtcaccgtctgtcgacg
gccgagattgagtcggcgctcatccagcaccctggtgtcgccgagacggcggttgtgggt
atcccagacgaagtcaccggtcagaccatcgctgcctacgtcacgcttaagcccgaattc
tcttacgactcggaagacgctctcaccaaggaactcgtcatccaggtacgaaggaacatc
ggtccctttgccgctcccaagaagatcattattgtttccgatctgcccaagacgcgttcg
ggcaagatcatgcgtcgtctgctgcgcaagtgcgcctcgcacgacacggacaacctcggt
gacttgagcagtctggctgatccttcggtcatcgaacacatcaaggagaagaccaacgct
tttgacaaaaagtga

DBGET integrated database retrieval system