KEGG   Ustilago maydis: UM03080.1Help
Entry
UM03080.1         CDS       T01021                                 

Definition
serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
uma  Ustilago maydis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    UM03080.1
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    UM03080.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     UM03080.1
Protein phosphatases and associated proteins [BR:uma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     UM03080.1
Transcription machinery [BR:uma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     UM03080.1
Spliceosome [BR:uma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    UM03080.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 331 aa AA seqDB search
MADNTTLEVDLDNVIDRLLEVRGSRPGKPVHLEEYEIKYLCLKARDIFINQPILLELEAP
IKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENF
FILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSP
DLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDISGWSENDRGVSFTFGPDVVSRFLQK
HDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKP
AEKKQKYAYGGINMGRPVTPPRKQKKKSDGK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaacaccaccctcgaggtggacctcgacaatgttatcgaccgtctcctagag
gttcgaggctcgcgtcctggcaagcccgtccatctggaagagtacgaaatcaagtacctc
tgcttaaaggcgagggacattttcatcaaccagcccatccttctcgagcttgaggcaccc
atcaagatctgtggtgacatccacggccagtactacgatttgttacgcttgttcgaatac
ggtggcttcccgcccgaggcgaattacctcttcctgggagactatgttgaccgtggtaag
cagtcgcttgagaccatctgcctcttgctcgcatacaagatcaagtacccggaaaacttt
tttatcctgcgcggcaaccacgagtgcgccagcattaaccgaatctatggcttctacgat
gagtgcaaacgtcgcttcaacatcaagctctggaagacatttaccgactgcttcaactgc
ctccccatcgctgcgatcattgatgagaagatcttcaccatgcacggtggcctttcgccc
gacctgcagagtatggagcagatccgccgcgtcatgcgtcccaccgacgtgccagacacc
ggtctgctttgcgacttgctctggtcggatcccgacaaggacatctcgggttggtccgaa
aacgatcgtggtgtctcgttcacatttggcccagacgtagtctcgcggttcctgcaaaaa
catgacatggatctcatctgccgagcgcatcaggttgtcgaagacggttacgaatttttc
gcaaagcggcaattggtcacgctgttctccgcgcccaattattgtggagagtttgacaat
gcaggtgccatgatgagcgtcgatgagacgcttctctgttccttccagatcctcaaacca
gcggagaagaagcaaaagtacgcgtatggcggtatcaacatgggccgccccgtgacgcca
cctaggaagcaaaagaagaagtccgatggcaagtga

DBGET integrated database retrieval system