KEGG   Ustilago maydis: UM03216.1Help
Entry
UM03216.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
uma  Ustilago maydis
Brite
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   UM03216.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2410 aa AA seqDB search
MSVLGTHQSDALNRIFAGLKSRDEATRQAAGEELKSHVALVVSELKGDSLSSFNNDLHRR
IFELAHSQHVHEKLGGVIAIEDLIEQESEDNSARLYRFYQYLKPNLPCNDASVMIAASRA
LGRVAYHGGQSLGEQFIEYEVLRVLDFLQAGDRNESGRYAAVLIIREMAKRVPQQFHPYV
PRVLDRIWVALRDVRVIVREGAAEAMGACLGIIAAREKQMGSHFFESIYEEAEKGLKMSA
PEAIHGSLLAVQQLLQHSKTFMRNRFQRACELVFRLHKHRDPLIRRTITNLVPVLARYDP
HYFAEEHLRAVMGILTEQLRREKDRSPKESAQTFETIGFVAAAMGPRMKPFIEPVLACVK
EGLQMRGKKNAPPEGPIFLCVGNLATAVGPHLTRYMHDLLDLMFSCGLSIPLVTALDGIV
KAIPPLMKVVQDRLLDMLSMTLIGQPYRPLGAPASLRPSANASRDVVAAQTVESKGVETI
TVALQTLGRFDFQGHILNEFVRNCTLPYLEDDHAAVRQAAAETCADLFVNDPICRQTSMH
AIEVVNDVLDKLMTVGIADPDPELRWTVLSKFGAQEQFDRHLAQSEYVRSLFIALNDEKF
KVREVAIVIIGRLAKHNPAYVMPSLRKALIQLLTELEYSTVSRHKEEAAKLLTEVVRASQ
RLVKSYALPMLEVLLPKANDPSVGVAARVMECLGELAKVGGEDLAPNVDQLMRLAIDQLS
STAPGSSTAKRDAALKTLGLVASNTGHVVNPYLTYRNLLGTVVKILKTEQSKPVRRETIR
VMGILGALDPYRYKLLEKNGDEGQDETSKGSGTDLFELALAIGTSTDDYYQNIAIDALIT
ILKDPSLSTHHHAVIEAIMYMFKTQGLKCVTFLPQIIPAFLNVIRTCGTGLSEFYFQQLA
ILISIIKQHVRSYLEPIFELVQENWNPNSSIQLTIVSLVEAVAKALEGEFKSYLPILLPN
MLQTLDGEITSKRQPTLLRILQAFYVFGSNIEEYLHLVLPVVVKMFERPDASQTLRRAAI
LTVGNLSRKVSFCDHASRVIHPLVRVLPTGTSDIRNAVMETLSALVVQLGASYAIFIPVV
NKVLIQNRIQHATYDQLVSKLLNGERLPQDLSAADNALGSKIDESPQAEANKMTVNQQHL
KQAWDTSKVSTSEDWQEWLRRMAVEFMRESPSHALRACRSLADVYPALAYGLFNVAFVSC
WTELYEQYQSDLVKALETAFDAPEVPGDVVHMLLNLAEFMEHDDKALPINIRVLGDRAYK
FHSYAKALHYKEAEFLTDPSPQVVESLIDINTKLQQSDAAFGALTYAREHLDITHHEEWY
EKLHRWEEALTAYDRKAMLDPDDYGVAFGKMRCLHALGEWEHLSDLVQQKWGRADMEDRR
HMAPLAAAAAWSLGQWDTMDDYISAMRSDSSERSFYRAILHTHRSQRAAANKQIAKARES
LDSELTALISESYGRAYDLMVRTQMLSELEEALAYKLDYKEQPDRQATIRSTWMKRLKGC
QPEVEVWQRILSVRSIVLTPADDTETWIKFANLCRKSGRMVLAEKTLNSLLGPERTNADP
RSPIGPRAPPPVIYAHLKFMWASGARIESLSYLQEFTLNLAEDLGVHTVDEHGNLVTQDW
QSSPHLGEFARLLARCFFKQGEWQMSLRENWVTDDNSNVIESYRRATELDRNWYKAWHAW
ALANFEVISHHEERNEQITPQMIAASIVPSVQGFFRSIALASGNSLQDTLRLLTLWFKYG
HQEDVSQAVSEGFASVIVDTWLEVIPQIIARITAPSPRVRRLIHNLLSDVGLAHPQALVY
PLTVAAKSPSHMRIQAAMGIMDNVREHSPVLVEQALLVSNELIRVAILWHEMWHEGLEEA
SRLYFTEDNIDAMFATLEPLHDALEKGPETLRETSFAQTHGRDLAEARECGRRFRQYGDI
SDLNQAWDLYYHVFKKIAKQLPAGNSVQLDLQYVSPKLLAMRDLELAVPGTYQSGKPIVC
ITRFEQIVLVIASKQHPRRLKMKGSDGKTYQYLLKGHEDLRQDERVMQLFGLVNTLLSID
SESYKRRLEIRRFPVIPLSPNTGMLGWVENTDTLHVLIKEYREQHKILLNIEHRLMLQMA
PDYDHLTLMQKVEVFEYALDNTPGQDLYRVLWLKSRNSESWLERRLAYTRSLAVSSVAGY
ILGLGDRHPSNLLLDRLTGQIVHIDFGDCFEIACHRPKFPEKVPFRLTRMLVNAMEVGGI
KGTFKVTAENTMRVLRDNKESVLALLEAFVHDPLISWRLVADDGAERAPDAKENEAVAAE
GGAASGTATGAVTGAANVGAGGTVAPNQRQDQALYPAAGAPGGGIALPPTATATATAAAA
AAPNAVQAGGQDMRNQRALEVVRRIQNKLSGRDFNPAESLSVAAQIERLVQDATSKENLC
VAFVGWCSFW
NT seq 7233 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccttggcacccatcagagcgatgcgctcaatcgcatctttgctggactcaag
agcagagatgaggccacacgtcaagcagctggcgaagagctcaaatcgcacgtcgcactc
gtcgtctcggaactcaagggtgacagcctctcctcgttcaacaacgatctacaccgcaga
atcttcgaacttgcgcacagtcagcatgttcacgaaaagcttggtggtgtcattgccatc
gaagacctcatcgaacaggaaagcgaggacaatagcgctcgtctctaccgcttctaccaa
tacctcaaacctaatttgccatgcaacgatgcttccgtcatgatcgccgcctcccgcgcc
ttgggaagggtcgcctaccacggcggtcaatcgctcggagaacagtttatcgaatacgaa
gtgcttcgtgtgctcgatttcctccaagccggcgatcggaacgagtcgggacgatacgct
gccgtgctcatcatccgtgaaatggcaaaaagggtgccgcagcagtttcatccctacgtt
cctcgtgtcctagaccgcatctgggttgctctccgagatgttcgtgtcatcgtcagagaa
ggggccgcagaagccatgggtgcctgtctcggcatcatcgctgcacgtgaaaagcagatg
ggcagtcattttttcgagtcaatctacgaagaggccgaaaagggcctcaagatgagcgca
cccgaagccatccacggaagcctgctcgctgtacagcagctgctgcagcactcgaaaacc
ttcatgcgcaatcgcttccagcgcgcctgcgagctcgtcttccgtctgcacaagcatcgc
gatcctctgatccgccgcaccatcaccaacctggtccccgtcctggcgcgctacgaccca
cactatttcgccgaggagcatctgcgagccgtcatgggcattctcacagagcaactacga
agagaaaaggaccgatcgcccaaggagtcagcacagacgtttgaaacaatcggctttgtt
gctgcagccatgggtcccaggatgaagcctttcatcgagccagtcctggcctgcgtcaag
gagggcctgcagatgcgcggaaagaaaaacgccccacccgaaggccccatctttctctgt
gtcggcaaccttgccaccgcagtgggtccacatctcacacgatacatgcacgacctcctc
gacctcatgttctcttgtggcctcagcatcccgctcgtcacagcactcgatggcatcgta
aaggcaattccgccactcatgaaggtggtacaggatcgtctcttggacatgctttccatg
acgctgattggacaaccctaccgcccgctcggagctcccgccagtcttcgcccctcggcc
aacgctagtcgcgatgtggttgccgctcaaaccgtcgaatccaagggtgtcgagaccata
acggtcgcactgcagacgctgggcaggttcgacttccaaggccacattctcaacgaattc
gtccgtaactgcacgctcccttacctcgaggatgaccatgctgccgtgcggcaagctgcg
gctgagacgtgcgccgacttgttcgtcaacgaccccatctgccgtcaaaccagcatgcac
gccatcgaggtggtcaacgatgtgctcgacaagctcatgaccgtcggcattgctgatcca
gatccagaactccgatggacagtgctcagcaagtttggcgctcaggagcaatttgatcgc
catcttgcccaatccgaatatgtccgttccctcttcatcgcgctcaacgacgaaaaattc
aaggttcgcgaggtggccattgtcatcatcgggcgtctggcaaagcacaacccagcctac
gtcatgccctccctccgcaaagcactcattcagctgctcaccgagcttgaatattcgacg
gtcagccggcacaaggaagaggctgctaagctgctgaccgaggtcgtccgtgcctcacaa
cgtctcgtcaagtcgtatgcgttgcccatgcttgaggtgctgttgcccaaagcaaacgat
cccagcgtcggtgtcgcggccagagtcatggagtgtctcggtgaactcgccaaagtggga
ggagaggatcttgcgccaaacgtcgatcagctcatgcgtcttgccatcgaccaactctca
agcaccgcacctggctcatccaccgcaaagcgggacgctgctctcaagacacttggtctc
gtcgcttccaacactggccacgtcgtcaacccatacctcacgtatagaaacctgctcggc
acggtcgtcaagatcctcaaaacagagcagtccaagcccgtccgtcgcgagacgatccgt
gtcatgggcatccttggtgctctggatccatacagatacaagctgctcgagaagaacggc
gacgagggtcaagacgagacatcaaagggaagcggcaccgacctctttgagcttgctttg
gcaatcggcacttcgaccgacgactactaccagaacatcgccattgatgcgctcatcacc
atcctcaaggacccttcgctctcgacacatcatcatgccgtcatcgaggccatcatgtac
atgttcaagacgcaaggtctcaagtgcgtcactttcctgcctcagatcattccagctttc
ctcaacgtgatccgcacctgtggcacgggcctgtccgaattctactttcagcagctagcc
attctcatctcgatcatcaagcagcacgtccgcagctacctggagcccatctttgagctg
gtccaggaaaattggaaccccaattcaagcatccagctcaccattgtctcgctcgtcgag
gcggttgcgaaagcgcttgaaggcgagttcaaatcatatctgcctatcttgctgcccaac
atgctccagacgctcgacggtgagataaccagcaagcgtcagcctacattgctccgtatc
ctgcaggccttctacgtctttggttcgaatatcgaggagtacttgcatctggtgctgccg
gtcgtcgtcaagatgttcgagcgcccggacgcgtcgcagacgcttcgacgtgctgctatc
ttgaccgtaggtaacttgtcgcgcaaagtcagcttctgcgaccatgcatcacgcgtaatc
caccctctggtccgtgtgctgcctacggggactagcgacattcgcaacgccgtcatggag
acattgtctgcgctcgtagtgcagctcggcgcttcgtacgccatctttattcccgtcgtc
aataaggtgctgattcaaaatcgtatacagcatgcgacgtacgatcagctcgtctccaag
ctgctgaatggcgaacgcctgccgcaagacctgtctgcggctgacaatgcgttggggagc
aagatcgacgagtcgccccaagccgaggctaacaagatgactgtcaaccagcaacatctc
aagcaagcctgggatacgtccaaagtgtcgacgagcgaagactggcaagaatggctcaga
aggatggcggtcgagttcatgcgcgaatcgccaagccatgccttgagggcctgcagaagt
ctagcagacgtttacccagcgttggcgtacggccttttcaacgtcgcctttgtttcgtgc
tggaccgagctgtacgagcagtatcagagcgatctagtcaaggcgcttgagacagcattc
gatgcacctgaagtgcctggcgatgtggtgcacatgctactcaatctggccgagtttatg
gagcacgatgacaaggcgttgccaatcaacattcgcgtgcttggcgaccgcgcatacaag
ttccacagctatgcaaaggcgctccactacaaggaggccgagttcctcacagatccttcg
ccgcaggtcgtcgaaagtctcatcgatatcaacaccaagttgcagcagtccgatgcggcg
ttcggtgccctcacgtacgctcgggagcatctcgacatcacccatcacgaagagtggtac
gagaagctgcaccgctgggaggaggccttgactgcgtacgaccgcaaagccatgctcgac
ccagacgactatggcgtcgcctttggcaagatgcgctgtctgcatgctttgggagaatgg
gagcacctatcggaccttgtgcagcagaaatggggcagagctgacatggaggaccgccga
catatggcgccgcttgccgcggctgccgcctggtcgctcggtcagtgggacaccatggac
gactacatttcggccatgcgctccgactcatctgagcgctccttctaccgtgccatcctg
cacacgcatcgttcgcaacgagccgcggccaacaagcagatcgccaaggctcgagagtcg
ctcgactcggagctcactgctctcatcagcgagagctatggccgtgcatacgacctcatg
gttcgtacacagatgctttccgagctcgaggaggcactggcatacaagctcgactacaag
gagcagcctgaccgccaggcgaccattcgctccacgtggatgaagcgtctcaaaggctgc
cagcccgaggtagaggtgtggcagcgcatcctctctgtgcgttcgatcgtgctcactccg
gccgacgatacggaaacgtggatcaagtttgccaacttgtgccgcaagtccggacgcatg
gtgttggctgaaaagacgcttaactcgctgctgggcccggaacgtacgaatgctgatcca
cgatcgccgattggtcccagagcaccgcctccggtcatctacgcccacctgaaattcatg
tgggcttctggagccagaattgagtcgcttagctatctgcaagagtttacgctcaatctc
gctgaggatcttggggtccacactgtcgacgagcacggcaaccttgtcacgcaggactgg
cagtcgtcgccacatctcggcgagtttgcacgcctgctggcacgctgcttcttcaagcaa
ggcgaatggcagatgtcgttgcgcgagaactgggtcacggacgacaacagcaatgtgatc
gagagctaccgcagagcgactgagctcgatcgaaactggtacaaggcatggcacgcttgg
gcgctggcgaacttcgaggtcatctcgcaccacgaggagaggaatgaacagatcactccg
cagatgattgctgccagtatcgtgccttcggtgcagggcttcttccgctcgatcgcgttg
gcgagtggtaactcgttgcaagacacgctccgcctgcttaccctatggttcaagtatggt
catcaagaggacgtctcgcaggcggttagtgaagggtttgctagtgtcatcgtggatacg
tggctcgaggtgattccgcagattattgcacgtatcactgcgccctctccacgagtgcgt
cgcctgatccacaacttgctgtcggatgtcggtctggcgcatccgcaggcgcttgtctat
cctctcacggtcgctgccaagagtccgagtcatatgcgtatccaggctgccatggggatc
atggacaatgtgcgcgagcactcgcccgttctcgtcgagcaggcgttactggtgtcgaac
gaattgatccgtgttgcgatcctgtggcatgagatgtggcacgaagggcttgaagaggca
tcgcggctgtactttaccgaggacaacatcgacgccatgtttgccacactcgagccgctc
cacgacgcgttggaaaagggccccgagacccttcgcgagacttcatttgcccagacgcac
ggccgcgacctggcagaagcgagggaatgcggtcgacgcttccgccagtacggtgacatc
tcggatctcaatcaggcctgggatctgtactaccacgtctttaagaagatcgccaagcag
ctgccggcgggtaactcggtgcagctcgacctgcagtacgtctcaccgaagctgctggca
atgcgagacttggagctggcggttcccggtacgtatcaatccggaaagccgattgtatgc
atcacgcgcttcgagcagatcgtgctcgtcattgcatcgaaacagcatcctcgtcgactc
aagatgaagggttccgacggcaagacgtaccaatatctgctcaaaggtcacgaggacttg
cgacaggacgaacgcgtcatgcaactgttcggtctggttaatacactgctctcgattgac
tcggagagctacaagcgtcgactcgagatccgtcggttccccgtgattccgctctcgccc
aacacgggcatgttgggctgggtggaaaatacggatacgctgcacgtactcatcaaagag
tatcgagaacagcacaagatcctgctcaacatcgagcatcgattgatgcttcagatggcg
ccggactacgaccacttgacgctcatgcagaaggtcgaggtgttcgagtatgcgttggac
aacacgccggggcaagatctgtaccgagtgttgtggctcaagtcgcgcaattccgagtcg
tggttggagcgacggttggcgtacacgcgttcgctggcggtgtcgtcggtcgcaggctac
atcctgggtcttggagatcgacacccttcgaatctgttgctcgatcggttgaccggtcag
attgtgcacattgatttcggcgattgcttcgagatcgcatgccatcgtcctaagtttcct
gaaaaggtgccgttcagattgacgcgcatgctggtgaatgcgatggaagtgggcgggatc
aaggggacattcaaggtaaccgcggagaacacgatgcgcgtgctgagggacaacaaggag
agcgtgttggcgttgttggaggcgtttgttcatgatccattgatttcttggaggttggtt
gcggatgatggcgccgagagggcgcctgatgcgaaggagaatgaagctgtagccgccgaa
ggtggcgctgcttccggtacggcgacgggtgcagtcactggtgcggccaatgtcggcgcg
ggtggaactgtggctcccaaccaacgccaagaccaagcgctttatcctgcagctggtgca
ccgggcggtggtatcgctctacctcccaccgccaccgccaccgccacggctgcagctgca
gctgcacccaacgccgtccaagcgggtggccaggacatgcgcaaccaacgcgctctcgaa
gtcgtccgtcgcatccaaaacaagctcagcggcagagacttcaatcccgcagaaagcctc
agcgtcgctgctcagatcgaacgcctcgtacaggacgccacgagcaaagagaatctgtgt
gtcgccttcgtcggctggtgttccttctggtaa

DBGET integrated database retrieval system