KEGG   Ustilago maydis: UM03270.1Help
Entry
UM03270.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
uma  Ustilago maydis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM03270.1
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UM03270.1
   00630 Glyoxylate and dicarboxylate metabolism
    UM03270.1
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UM03270.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 341 aa AA seqDB search
MSGSLVTFGLYFFHNAHELVRSGFGPYFYLPKMESHLEARLWNDVFNLSQDYIKMPRGTI
RGTVLIETITAAFEMDEILYELRQHSSGLNCGRWDYIFSFIKRQRYTNGSILPDRSAVTM
TVPFMQAYVNLLIQTCHKRGVAAIGGMAAQIPIKDNPQANEAAMEKAGHDGTWVAHPALV
KIALEIFDKHMLGPNQYHVRREEVKVSALDLLNSNVPGQITEAGVRANVAALLVYCANWL
NGLGCVPVANMMEDAATGEISRLGLWAWVYHKQKTAEGNAITPAYVDRILDEEAAKVTKI
GASVEKAKRYISEQVRAPAPDEFLTSALYSHLPHQHAPARI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctcgctggtgacttttggtctctactttttccacaatgcgcatgagctggtc
cgatcgggcttcggtccttacttctacctgcccaagatggagagccatctcgaggctcgc
ctgtggaacgacgtcttcaacctctcgcaggactacatcaagatgccacgtggtactatc
cgaggtactgtcttgatcgagaccattactgccgcttttgagatggacgagatcctgtac
gagttgcgccaacactcttcgggtctcaactgcggtcgatgggactacatcttttcgttc
atcaagcgccagcgttacacgaacggctcgatcctgcccgatcgttcggcggtgaccatg
acggtgcccttcatgcaggcctatgtcaatttgctgattcagacttgccacaagcgcggt
gttgccgcgattggtggtatggctgctcagatccccatcaaggacaacccgcaggccaac
gaggcagccatggaaaaggctggtcacgacggcacttgggttgcccaccctgcgcttgtc
aagattgcgcttgagatctttgacaagcacatgctcggacctaaccagtaccacgtgcgt
cgcgaggaggtcaaggtttcggctctggatctgctcaactcgaacgttcccggtcagatt
acggaagccggcgtgcgtgccaacgtagctgcgttgctggtgtactgcgccaactggctg
aacggtcttggctgtgttccagtcgctaacatgatggaggatgctgctacgggagagatc
tcgcgtctcggactgtgggcatgggtgtaccacaagcagaagactgccgagggcaatgcg
atcacgcctgcgtacgtcgaccgcatccttgacgaggaggcggccaaagtgaccaagatc
ggtgctagtgtcgagaaggccaagcgttacatttctgagcaggttcgtgcccctgcgccg
gacgagttccttacttcggctctctactcgcaccttcctcaccagcacgcgcctgcgcgt
atctga

DBGET integrated database retrieval system