KEGG   Ustilago maydis: UM03299.1Help
Entry
UM03299.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:uma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:uma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:uma00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:uma00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:uma00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 248 aa AA seqDB search
MARTFFVGGNWKMNGSLESTKQLTQTLTQAKLDSNVEVVVSPPALHLLAVQEQLKGSKVA
VAAQNAYHKPSGAFTGEVSVTMLKDAGIPWVILGHSERRTLFHESDANVAEKTAAALAEN
LSVILCIGETLEQREANETVNVVVRQLDAVADHVKDWSKIVVAYEPVWAIGTGKVATSEQ
AQEVHAAIRKWATEKLGKDTADQLRIIYGGSVAAKNCKELAQRPDIDGFLVGGASLKPEF
VDIVNANA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcactttcttcgtcggtggtaactggaagatgaacggctcgcttgagtcaacc
aagcagctcacccagactttgacacaggccaagctcgactccaatgttgaggttgtcgta
tctccgcctgcgcttcacctgcttgccgtccaggagcagctcaagggctccaaggtagcc
gtggcggcgcagaacgcctaccacaagccaagtggagcgttcactggcgaggtctcagtt
accatgctgaaggacgccggtatcccctgggtcatccttggtcactcggagcgacgaact
cttttccacgaatctgacgccaacgttgccgaaaagactgcggccgctctcgccgaaaac
ctctcggtgatcctctgcatcggtgagacgcttgagcaacgcgaagccaacgagacggtc
aacgtcgtcgttcgtcaactcgatgctgtcgctgaccacgtcaaggattggtccaagatc
gtcgtcgcgtacgagccggtttgggccatcggaacgggcaaggtggccacctcggaacag
gctcaggaggttcacgctgcgatccgcaagtgggccactgaaaagctcggcaaggacacc
gccgaccagctcagaatcatctacggcggctcggtcgctgctaagaactgcaaggagctc
gctcagcgacccgacatcgacggcttcctcgtcggcggcgcttctctcaagcccgaattc
gtcgatatcgtcaacgctaacgcttga

DBGET integrated database retrieval system