KEGG   Ustilago maydis: UM03300.1Help
Entry
UM03300.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
uma  Ustilago maydis
Brite
Exosome [BR:uma04147]
 Exosomal proteins
  Proteins found in most exosomes
   UM03300.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 162 aa AA seqDB search
MSWQGYVDTNLVGTGKISQAAIIGLKGGVWATSSDFNLTAEEQKAIIAGFDDPSGLQAGG
VRANGKKFFTLGVTPRTIYGKQGVSIPALSLTFSRLGASHRSYSFADVVSNYLPIGGNQG
DGLVAVKTNQAVLVCVYMAPIVPGEANKVAEGLGDYLVSVGY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaaggatacgttgacacaaacctggtcggcacgggcaagatcagccaggct
gccatcatcggtctcaaaggtggtgtttgggcgaccagctcggatttcaatctcactgcc
gaagagcaaaaagcaataattgccggcttcgacgatccctcgggcttgcaagctggtggt
gtgcgtgctaacggcaaaaagttcttcacactcggtgtcacaccaaggacgatttacgga
aagcaaggtgtaagtatccctgcgctttcgctaactttttcccgcctcggcgcttcgcat
cgctcgtattcgttcgctgacgtcgtttccaactatctacccatcggtgggaatcaggga
gacggactggtagcggtcaagaccaaccaagccgtgctcgtatgcgtttacatggcaccg
atcgtccccggcgaagccaacaaggtcgctgagggtctcggtgactacctcgtcagcgtc
ggctactga

DBGET integrated database retrieval system