KEGG   Ustilago maydis: UM03302.1Help
Entry
UM03302.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UM03302.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1283 aa AA seqDB search
MIRVVLFSCLSAKIRLNEAVSSEQHHPLHHRRSHWQEKLQRQFGRVPLLLDDSTEQHQEQ
LRLTWSLSARPTGWPVQTITDSVISLDHQKGTQNSFSLIDPAVEPPSTHHVMLSNHSSSD
SRAMMTVQPLSSATAPLAAGPSGSRLPASPSKRVRTRQIAGASVSPAKKRRLKTLPAVKK
RPPTRPATRRAPPQETCAFCLQPADRSRGGTPKLLISCYECGSSGHPSCLKWGRKSTKVH
KALSYNWRCIECKKCEVCDDKGDDAQLMFCDRCDRGWHLYCLTPALSKPPKGQWHCPTCV
AGDQHHQWSLPACPASTHLPSQIVRVSSSGRQSKPSNPDRSIDSLLTAHASLHRAKDAQL
LAGPNFAVMNTLKNGLLSAAGSLLNFAPVSPWSPRSKIQTGMMPSSLNSSSKQTATGGGG
SARGGKRGRPRKSAGASRSNQRPVSSLTGADRHASSSRNARLGDQEGSDSSDGEHGLEHG
VHDGDSTKDVREDDEDDAAGECDAKSSEEEDPFGGVLEGSDALTLPYKPTPQDIERFQRA
QQAAQDKLGGILADLPASSGSRVVRRPGLTPTVISSSAAASPRHASSIIPTDSPIGTSRT
SRAQLVTRHSPSSTSVLSQVEITTAASSAETGTASPIKCIRFGEFDIDTWYQAPYPEEYS
MVPDGRLWICEFCLKYMKSRFMAQRHRLKCKMRHPPGDEIYRDGNICVYEVDGRKNKIYC
QNLCLLAKMFLDHKTLYYDVEPFLFYIVTEGDSTGDHFVGYFSKEKRSPMNYNVSCIMTL
PVRQRRGWGNFLIDISFLLSKKEGRTGTPEKPLSDLGLLSYRNYWTLAVFYYLRTAPDEV
SMDDISRATAMQLEDIYYVLAEKDMIVVYDGNNANSRTPATSKYRAREGIAAGSASAGGT
SSAPESQLRKRGRPPLQHRPPPATRLPSYKDRDKNAAASLPRDYRIHFDRDYVIAHLKNY
ESKGYLKVRADKLKWTPFLVSRSFPQPISSAINGHSVCSGVGHSNGTPAPSGSGTFTPAE
MMANLGYSVLNQVQKTPGRADTVSARASPAAAAGRRNMALVGPAAASPAAIGASNSANAS
LPSSPGQIPIATPTPSSPKKRNRPVPPAGNALYDITLGNTKSEEDGPRSQAEIASGLVGS
LQVSPDISSSKTATANIDVAGAADAWDEDLDADGDADGEHEADEYVYDTSAPLTKQESQS
TIAPGTEPLSVNAQRLERVLTASSGAPSGPAIRVSPQVQLPLEVANPWQARDGATTTPDA
YDAEYDLGDEDADGSDDPALEEI
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgttgtcctcttttcgtgtttgtctgcgaagatcaggctcaacgaggctgtc
tcatctgaacaacatcatcctttgcaccaccgaaggtcacattggcaagagaagttgcaa
cgacaatttggtcgtgtaccgctgctattggacgattcgacagagcaacatcaagaacaa
ctgcggcttacttggtcactttcggctcgaccgactggatggcccgttcagacgatcaca
gactcagtcatttctttggatcaccagaaaggcactcaaaacagcttttccctcatagat
ccggctgttgaaccaccatcgacccatcatgtcatgctctcgaatcactcttcatctgac
agcagagcgatgatgaccgttcagccactcagttcggcaactgctccgctcgcagctgga
ccatctggctcaagactccctgcatcgccctcgaagcgagtccgcacaaggcagattgca
ggagcgtcagtgagcccggcaaagaaacgcaggcttaagactttacctgccgtcaaaaaa
agaccgccgacaagacccgcgactcgacgagctccaccccaagagacgtgtgccttctgc
ttgcagcctgctgataggtcaaggggtggtacacccaagctgctcatttcgtgctacgaa
tgcggcagcagcggacatccctcgtgcctcaagtggggtcgcaaatcgaccaaagtgcac
aaagccttgtcgtacaattggaggtgcatcgaatgcaagaagtgcgaagtttgtgacgac
aaaggtgacgatgcacagctcatgttctgcgatcggtgcgaccgtggctggcatctctac
tgcctaactcctgctctttcaaaaccacccaagggtcaatggcactgcccgacctgcgta
gccggcgatcagcaccatcaatggtcactgccggcctgtcccgcttccacgcatctcccc
agccagatcgtacgtgtctcgagctccggcagacaaagtaagccctcgaatccggatagg
agcatcgactcgcttctgacggcgcacgcctcacttcatcgggccaaagatgcgcagctg
ctcgctggccccaatttcgccgttatgaacacgctcaaaaatggcctgctcagcgcggct
ggctctttgctcaactttgctcccgtctctccatggtctccacgctcgaaaatacagacg
ggcatgatgccttcatcgttgaacagctcttctaaacagacagctactggtggcggaggg
agtgccagaggcggcaagcgaggtcgtcctagaaaatccgccggtgcgtctcgatccaat
caaaggccggtttcgagtctgactggtgcagatagacatgctagcagcagcaggaacgcc
aggctcggcgatcaagagggctcagattcttcggacggagaacacggcttagaacatggc
gtacacgatggagattcgacgaaggacgtccgagaagatgacgaagacgatgcagccggt
gagtgtgacgccaagagcagcgaagaagaagacccgttcggcggcgtgcttgaagggtcg
gatgcactcacgctgccgtacaaaccgacaccgcaagacattgaacgttttcaacgtgca
caacaagctgctcaagacaagcttggtggcattcttgccgacctaccagcaagttcgggc
agtcgcgtggtcaggcgacccggactgactccgactgtgatctcaagttcagcagctgca
tcaccgcgccacgcgagctcaatcatccctacggactcacccattggcacatctcgtacc
tcccgtgcacagcttgttactcgacattcgccatcaagcacatcagtgttatcgcaggtt
gagatcaccaccgcggccagcagtgccgagacgggaaccgcttcaccaatcaaatgcatc
cgctttggcgagttcgatatcgacacttggtaccaagcgccttatccagaagagtacagc
atggtacccgacggacgtctgtggatctgcgagttctgcctcaagtacatgaagagccgc
ttcatggcacagcgtcaccgactcaagtgcaagatgcgacatccaccaggcgacgagatc
tatcgtgacggcaacatctgcgtgtacgaggtcgatggcaggaagaacaagatctactgc
cagaacttgtgcctgcttgccaagatgtttcttgatcacaagacgctctactatgatgtg
gagcctttcctgttctatatagtcacagagggtgacagcacgggcgaccactttgtgggc
tactttagcaaggagaagcgcagtccgatgaattacaatgtctcatgtatcatgacactg
ccagtgcgccaaaggaggggatggggtaattttttgatcgacatcagctttctgctctcc
aaaaaagaggggcgaaccggtacgcccgagaagccgctcagcgaccttggtctgctgagc
taccgcaattactggacgctggctgtattctactatttgcgcacagccccggacgaggtc
agcatggacgacattagccgcgcaacggccatgcagttggaggatatctactatgtgctt
gcagagaaagacatgattgtagtttatgacggaaacaacgcaaacagccgaacgccagca
acaagcaagtaccgcgcgcgggaaggcattgcagcgggctctgcctcagctggtggtacc
tcttctgcgcccgagtcgcaattgcgcaaacgtggtaggccgccgctgcagcacagaccg
ccacctgcaacccgattgccttcgtacaaggacagggacaagaatgcggctgcttccctc
cctcgcgactatcgcatccactttgatcgtgactacgtgatcgcgcatctcaaaaactac
gaatccaaggggtatcttaaggtgcgagccgacaagctcaaatggacgccgttcctggtg
tctcgctcttttcctcagcccatctcgagcgcgatcaacgggcacagcgtgtgctcaggt
gtcggacattcgaatggtactccagctccgtctggaagcgggaccttcacaccagcagaa
atgatggcgaatttgggatactctgtgctcaatcaggtgcaaaagacgcctggcagggcg
gataccgtgagtgctcgcgcaagcccagctgctgcagctggtcggcgcaacatggcgcta
gttggtccagcagcagcgagtccagcggcaatcggtgccagtaattctgccaatgcatct
ctacccagcagccccggccaaatcccgatcgctacaccgactccatcgtcacccaagaag
cgaaacagacctgtgccacccgctggaaacgctttgtatgacatcacgctaggcaacacg
aagagcgaagaagacggaccgagaagtcaagcagagatagcatcaggcctagtcggttct
ctgcaagtaagcccggatatttcttcctcgaaaactgctacagccaacatcgacgttgca
ggcgccgcggatgcgtgggacgaagacttggatgcagacggagatgccgatggcgaacat
gaagccgacgagtacgtgtatgacacctctgccccgctgacgaagcaagagtcgcagtcg
acgatcgcgcctgggacggaaccactttctgtcaatgcgcagcgtcttgagcgtgtgctt
acggctagctcaggggcgcccagtggtcctgcaatacgcgtttctcctcaagtgcaactt
ccgctggaggtggctaatccatggcaagcgcgtgacggtgctaccaccacgcctgacgcc
tacgatgcagaatatgaccttggtgacgaagacgctgatggcagcgacgatcctgctctt
gaagaaatctaa

DBGET integrated database retrieval system