KEGG   Ustilago maydis: UM03411.1Help
Entry
UM03411.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 344 aa AA seqDB search
MKTNFLVLLSALLAASSAVTATLIPAKCKHEAFSQRAGSSLNAAIKSDGRKYFGTCADPG
TLGNWQISNIIKAEMGQVTPENSMKWDATQPQRGTFNFGNADRLVDFATSNGKLIRGHTL
VWHSQLPSWVSSITDANDLTNVIQNRIATVVGRYKGKVYAWDVVNEMFNENGSFRESVFY
KLLGEDFVKIAFEAARKADPNAKLYINDYNLDDPDYPKLKSLVANVKKWRSQGVPIDGIG
SQSHLQAAGHFLDASKVGGAMQALCAAASECAMTELDIAQASPDQYTKATEACLNQKNCV
GITVWGVSDNTSWRKNANPLLWNSSYQKKPAYNAVLSTLNSYQA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaactttctcgttctcctctccgcccttctcgcagcttcttcagccgtgacc
gccacgctgatccctgccaagtgcaaacacgaggcgttctcgcagagagctggctcgtcg
ctcaacgcagccatcaagtcggatggtcgcaagtactttggtacttgcgccgacccgggc
acgttgggcaattggcagatcagcaacatcatcaaggctgagatgggtcaggtgaccccg
gaaaattcgatgaagtgggatgccactcaaccgcagcgcggcacgtttaactttggcaat
gccgatcggctcgtagactttgccacctcaaatggaaagctgatccgaggtcatacgctc
gtctggcactcgcagcttccttcatgggtctcgtccattactgacgccaatgaccttacc
aacgtaattcagaaccgaatcgccaccgttgtgggaagatacaagggcaaggtctacgcc
tgggatgtagtgaacgagatgttcaacgagaacggttcattccgcgagagcgttttctac
aagctcctcggcgaggactttgtcaagatcgccttcgaagcggccaggaaggcggacccg
aacgccaaactctacatcaacgactacaatctcgacgatcccgattatccgaagctcaag
tcgctcgttgctaacgtcaaaaagtggcggtcgcagggtgtcccgatcgacgggatcggc
tctcaatcgcatctgcaggcggctggtcatttcctcgacgcctcaaaggttggcggtgcc
atgcaggcgctttgtgctgctgcgtcggagtgcgccatgaccgagctagacattgctcaa
gccagccctgaccagtataccaaggctaccgaggcctgcctcaaccagaagaactgcgtt
ggcatcaccgtttggggtgtttctgacaacacttcatggaggaaaaacgccaaccctttg
ctttggaacagcagctaccagaagaagcctgcttacaacgccgtgcttagcactctcaac
tcgtaccaagcttga

DBGET integrated database retrieval system