KEGG   Ustilago maydis: UM03676.1Help
Entry
UM03676.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
uma  Ustilago maydis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UM03676.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     UM03676.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1060 aa AA seqDB search
MDTNAHHAAQPKPARPRGTLGLKRASHSALASAGFASPSRIARATSTDSVVTPAKRARLV
LPTQQEHDDHLDSESIPAATVGANDTPPSHAFLLSRNSSNQASSSSNAASPSSNSFGPFY
LCTWRKPQQKKHKTWDGDAILVVKDAGERCTLICSQTGKQLVASARFAFNRLSFGDELAL
GGKEIEIDREIDLLEYRKLIAFTRGELSPLRNAPPPTATRTLKPFAIPTRRSTIKPVDLN
QITPARAETFYGKPAPKLIRKLPDLDHDPSASRNTSPSRVSGLNNPGNGQTPHPRFDPNE
PGAIVMKRPDERHQRAHNPKRRPVVDVVLDPQLTKALRPHQVEGVKFLYERVMGMHADGT
KGKGAILADEMGLGKTLQTIALILTLIKQSCYYTSKSSTIERAMIVCPLTLVKNWKREFR
KWIGSNSLNVLCIDEDCGREHVERFARSKAYHVMVIGYEKLRSCIDIVKTAQPPVDLIVC
DEGHRLKSKDAQTTKMFDELSTERKIILSGTPIQNNLSELYAMIDFVIPDLLGKPESFKT
LFEEPILRSRAKHASKHAKAVGQARLGALMTVTKDIILRRTADILTKFLPPKHEMVLFCS
PSEEQLRIYQAILGSSQVRSLLQGAPGNGLLQIGVLRKLCNSPELLLKDTEADADSPTKA
LVGDLTRFFPPNFVRNEARFGGKLICVMNLLQTVRAQTDDKVVLVSNFTSTLDIIEAMMR
KKRYPYLRLDGKTPQDERMAMVNQFNREGVDKSFVFLLSAKSGGVGLNLIGANRLVLIDS
DWNPSTDLQAMARIHRDGQKKPCYIYRLLLSGTMDEKIYQRQISKLGLSDSLMNAEKKTT
SDTFSQEELRDIFTLHLDSTCISHRQLLCDCDGKGGSATLDKPEQTSSGTWTDSQSSTNS
DDDEQLPGFVAASQHAVDKTAQDKLERRKKLLALYKWAHYDCVLHPNHFDHDEIAAAIIR
NARHERRANKVATSLVKTEPDDEWSRNMKHRDDDLVFSSADDDDQEDEVDDPALSGLGGS
SDFRLDEVEAGRILFVFAKNSDAATDKAASPTLTTPPALD
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaatgcgcatcacgctgctcaacccaagccagctcgtccacgaggcacgctc
ggtctcaagcgcgcatcccactcggccctagccagcgctggctttgcttctccatctcgc
atcgccagggccacttctaccgatagcgtcgtcactcctgccaaaagggccagactcgtg
cttccgacacagcaggaacacgatgatcatctcgattccgaatcaatacccgcagccacc
gtaggcgcaaatgacacaccgccttcgcatgctttcctgctcagccgcaactcgtccaat
caagcctcctcatcttccaacgcagcatcaccttcgtccaatagtttcggtcctttctac
ctctgcacctggagaaagccacagcaaaagaagcacaagacctgggacggtgatgccatc
ctcgtcgtaaaagacgctggagaacgttgcaccctcatctgctcacagaccggcaagcaa
ctcgtcgcatccgctcgctttgcattcaaccgtctctctttcggcgacgaattggcgctc
ggtggcaaagaaatcgagatcgatcgagaaattgacctcttagaataccgcaagctcata
gctttcacccgtggagagttatcacctcttagaaacgctcctccacccacagccacccgc
accctcaagccctttgctatacccacaagacgttccaccatcaaaccggtcgatctcaat
cagattactcctgctcgagcagaaaccttttacggcaagcccgctcccaaactcatccgc
aaactccctgacctcgaccacgatccgtctgcctcgcgaaatacaagcccctcacgcgtt
agcggactcaacaatcccggcaacggtcaaactccgcatcctcgattcgaccccaacgaa
cccggcgccatcgtcatgaaacgccccgacgagagacaccaacgtgctcacaatcccaaa
cgccgtcccgtcgtcgacgtcgtcctcgatccgcaactcaccaaagcattgcgtcctcat
caggtagaaggcgtcaaatttttgtatgagcgtgtcatgggcatgcatgccgacggcaca
aagggcaaaggcgccatcttggccgacgaaatgggtcttggcaagacgctccaaaccatc
gcgctcatcctcaccctcatcaagcaatcctgctattacacctccaagtcgtccaccatc
gagcgtgccatgatcgtctgcccactcacactcgtcaagaactggaagcgcgagtttcgc
aagtggatcggctccaattctctcaacgtgctctgcatcgacgaggattgcggtcgtgag
catgtcgagcgctttgcccgctccaaggcctaccatgtcatggtcatcggctatgaaaag
ctcaggagctgcatcgacattgtcaaaaccgcccaaccgcctgtcgatctgatcgtttgc
gacgagggtcacagactcaaatccaaggatgcccagaccaccaaaatgtttgacgagcta
tcaaccgaacgcaaaatcatcctctcgggcacgcccattcagaacaacctctccgaactc
tacgctatgatcgactttgtcattcccgatctgctaggcaagccagagtccttcaaaacc
ctctttgaggaacccatcctgcgctcacgcgccaagcacgcctccaagcacgccaaagct
gttggccaagcacgcctcggtgcactcatgaccgtcacaaaggacatcatcctccgtcgc
actgccgacattctcacaaagttcctcccacccaaacacgagatggtgctcttctgcagc
ccgagtgaggagcagctgcgcatctaccaggccatccttggctcgagccaagtgcgctcg
ctcctccagggcgcaccgggcaacggccttttacagatcggcgtgctgcgaaagctgtgc
aacagcccagagctcttgctcaaagataccgaagcagatgccgacagccccaccaaggcg
ctcgtaggcgacctgacgcgcttcttcccacccaattttgtacgcaacgaagccaggttt
ggcggtaagctcatctgcgtcatgaacctgcttcaaacggtcagggcacagaccgatgac
aaggtggtgctggtctccaactttaccagcaccttggacatcatcgaggccatgatgagg
aagaagcgctacccttatctccgactggatggaaagacgccgcaggatgagaggatggcc
atggtcaaccagttcaaccgcgaaggcgttgacaaatcgtttgtctttctgctttcggca
aagagcggcggcgtgggtctcaacctgatcggtgcaaatcgattggtgctgatcgactcg
gactggaatccgtccacggatcttcaggcgatggcacgcattcatcgagacggacagaag
aagccatgctacatctaccgattgctgctttcgggcaccatggacgaaaaaatttaccag
cgacaaatctccaaactcggcctatcagattccctcatgaatgccgaaaagaagacgaca
tcggacacattctctcaagaagagcttcgtgatatctttacgctgcatctcgattcaacg
tgcatcagccaccgacaactcctctgcgactgcgacggcaaaggtggcagtgctacactc
gacaagcctgaacagacttcatccggtacatggaccgatagccaaagctcgacaaacagc
gacgacgacgagcaactgccaggatttgttgctgcatcgcagcatgctgtcgacaaaaca
gcgcaagacaagctggaaagacgcaagaaattgcttgcgctttacaagtgggcgcattac
gactgcgtgctgcacccgaaccattttgaccacgacgagatcgcagctgccatcatccgc
aatgctcgacacgagagaagagcgaacaaggtcgcaacatcgctcgtgaaaaccgagccg
gacgacgagtggagtcgcaacatgaagcatcgagatgacgaccttgtcttttcatcggcc
gacgatgatgatcaggaggatgaggtagatgatccagcgctctcgggcttgggcggcagc
agtgacttcagattggacgaggtcgaagcaggtcgaatcttgtttgtgttcgccaagaac
tcggacgcggccacagacaaggcagcgtcacctacgctcacgactccgccggcactcgac
tag

DBGET integrated database retrieval system