KEGG   Ustilago maydis: UM03762.1Help
Entry
UM03762.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
uma  Ustilago maydis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UM03762.1
Messenger RNA biogenesis [BR:uma03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     UM03762.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 395 aa AA seqDB search
MAFFSSASTPSTFGARPAATPGQINTSAATKTSGDQDQEVAPGATDTVSCLAFSPTADFL
AVGSWDNNVRIYQINKTSPTPVQPWQQYSHEAPVLDLCWSTDGAKVFSVGADKVCRMFDM
NTNQPTVVAQHADTIRSVCWLNVAGGVLLTAGWDKQLKIWKIDNPASPQAVHSLTLPEKC
YVMDNVQNVVVVAMAERMVLGFRLEETGSITPLTEQQSPLKYQTRSMAVLPDGDGYALGG
VEGRVGVQYFHDPPDKDNKVKKFAFKCHRRANADHPEVPRNESHLFPVNCIAFNVHGTFA
TGGADGSINFWCKQSRTRLKTMETKGPANAPKELLKTNPAKQPITAIGFNRDATILAYAV
GYDWHKGYAGAGAVEPKVYIQPVNYEDVKKRPPKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcattcttctcatctgcatccacgcccagcacgtttggtgcacgccctgcggccacc
ccggggcagatcaatacttcggcagcgaccaagacaagcggcgatcaggatcaagaggtc
gcacccggcgccaccgacaccgtcagctgtctcgcattctctcccaccgccgacttcctc
gccgtaggaagctgggacaacaacgttcgcatctaccaaatcaacaagacttccccaacg
cccgtgcaaccgtggcagcagtattcacacgaagcgccagtgctcgatctttgctggagc
accgacggcgccaaagtgttttccgtcggagccgataaggtgtgtcgtatgttcgatatg
aacactaatcagcctacggtggtggcacagcacgctgatacaatccgaagcgtttgctgg
ttaaacgtcgctggcggcgtgttgctgacagcgggttgggacaagcagttgaagatctgg
aagatcgacaatcccgcatcgccgcaggcggtgcattcattgacgctgcccgaaaagtgt
tacgtcatggacaacgtgcaaaacgtagttgtagtggctatggccgagcgaatggttctt
ggattccgattggaagaaacaggctccatcacgcctctcaccgaacagcaaagccctctc
aagtaccagacccgctccatggccgttcttccagatggtgatggttacgctctgggtgga
gtagaaggtcgtgtaggagtacaatacttccacgatccaccagacaaggacaacaaggtc
aagaaattcgccttcaaatgccatcgtcgcgccaacgccgatcacccagaggtaccgcgc
aacgagtcgcacctcttcccggtcaactgcatcgcattcaacgttcacggcacctttgcg
acaggaggtgcagacggaagcatcaacttttggtgtaagcagtcgaggaccaggttgaag
accatggaaacaaagggtccggctaacgcgcccaaggagttgctcaagacgaacccggct
aaacagccaatcaccgcgatcggattcaacagagacgcgacgattctggcttatgctgtc
ggatacgattggcataaaggctatgctggggcgggggcggtggagccgaaagtgtacata
caaccggtcaactacgaggacgtgaaaaagagacctcccaaagcatga

DBGET integrated database retrieval system