KEGG   Ustilago maydis: UM03777.1Help
Entry
UM03777.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UM03777.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UM03777.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 918 aa AA seqDB search
MVPPISVADASTRSSIAVASASTTPLAASSSKHPYSQKWSSTSPRASHLHPSASQSSSAL
ASTSSSASPSVSTASSTHQLYAGTPSSSSSSSSSSLPPSSSSLAPPSLNAPTFVSQSLIH
DYHCQSRPEILSSARLLVPQAGRLSPLANQKRLAAAHQVSPPASSSRKSRLDPHLQPFDT
DLGAAFRPPSPSSAPPLTISYRCCPELPHLASWSALLESLPKQPKRLNQPSLASQTPEST
PAPSSISTHPSSPLTSDHPDLAASSLTEATSVAAPDAASSSAVGTPQLNPPKINAWGTPK
SWADTLVRNGSNSKAPIGISVNVGHDYASSASDVDSPSVARSPKAINGKKAARKSGATQA
KPTVMSLERLLADAHTRFDAPVTHPRGLVNKGNFCFANAILQTLVYCAPFYNLFNLVANQ
ISADFGNATPLMEAVIQFLREFLPVDSSTSLDARHPGQDGFIAAASEPFVPEFVYDAMRL
NKRFDQMRRGHQEDAEEFLGFFLDTLHEELISAQRRSALKLAQSASAPNGLLSKMSDDEK
KLNGVSDDDLKRLGVRVGKDAASADAVGLGLDAAFDEDDIVEREVMRPVSPSEQGWMEVG
QKGKTAYTRTTSTSESPITRIFGGKLRSVLKTPGAKDSVTLEPYQPLQLDIQPAHVQSIE
DALLHLTEPETIPGVWSPSRSAQVDATKQVFIESLPPVLVLHLKRFIYDEIGGVQKSQKP
LSYGSTLEIAPDVLSPAMRSQPRPRYRLFGIVYHHGRHASGGHYTVDVLRQDGLSWLHID
DTLFYNVATEHVVRNAASTSKDHAHDGLAYLLFYRRELAGEAEAASAPAPAPAAAQPNAV
CDSTKYALPDALFGNRAPLATRTPARKPAPAKRTLHNSVQGANANPGSAASPVQPHPKLG
ASAPQCKPARKAVPGWDR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggttcctccgatatctgtcgctgatgcgtccacccgcagctccattgccgttgcttcg
gcatcaaccactccgttagctgcctcttcgtcaaagcatccctattcacaaaagtggagc
tcaacatcgcctcgggcgagtcatttgcatccatcagcatcccaatcatcatcagcactc
gcatctacatcatcatcggcatccccatcagtgtcaaccgcgtccagcacacatcagctt
tacgcaggcacaccatcatcatcatcatcatcgtcgtcgtcatcactaccaccatcatcc
tcatcactcgctcctccatccctaaacgctcctacctttgtctctcagtctttgatacat
gattatcattgccagtcccggccagagatcctctcgtcagctagactcctcgtgccccaa
gccggtcgactctcaccgctcgccaaccaaaagcgactggcggctgcacaccaagtttct
cctcctgcctcctcgtctcgcaaatcacgactcgatccacaccttcaacctttcgacact
gaccttggcgccgcttttcgtcctccatcgccttcatcagcgccgcctctcaccatctcc
taccgctgctgtcctgagctcccccacctagccagctggtcggctcttctcgagtcgcta
cctaaacagccaaaacgtctcaaccaaccctcactagcatcacaaacccccgaaagcaca
cccgctccctcatccatctcgacccatccatcgtcccctctcacatccgaccacccggat
cttgccgcctcctctctaacagaagctaccagcgtagctgcacccgacgcagcctcctcg
tccgccgttggaactcctcagcttaacccacccaaaatcaatgcttggggcacacccaag
tcctgggccgacaccctcgtccgcaatggctccaattcgaaagctcccatcggtatcagc
gtcaacgtcggccacgactacgcttcgtccgcctccgacgttgactccccttccgtcgca
cgctcccccaaagccatcaacggcaagaaagcggctcgcaagtcgggcgctactcaagcc
aagcccaccgtcatgagtctcgaacgtctgcttgcagatgcacacactcgcttcgacgct
cccgtcacccaccctcgcggtctcgtcaacaagggaaacttttgctttgccaacgccatt
ctccagacgctcgtctactgtgcacccttctacaatctcttcaacctcgtcgcaaaccaa
atttccgccgactttggaaacgccaccccgctcatggaggccgtgattcagttcttgcgc
gagtttctccccgtcgattcctccacatcgctcgacgcacgccaccccggacaggacggt
ttcattgctgccgcctcggaaccattcgtccccgaatttgtctacgatgccatgcgcctc
aacaagcgcttcgaccagatgcgccggggtcaccaagaggatgccgaagaatttctcggc
ttcttccttgacacgctccacgaggagctcatctcggcgcagcgtcgatccgccctcaaa
ctagcacagtcagccagcgctcccaacggtctgctttccaagatgtcggacgacgagaag
aagctcaacggtgtatccgatgacgatctcaagcggctcggcgtacgcgtcggcaaggac
gctgcctcggctgatgctgtcggtctcggtctcgatgctgcgtttgacgaggacgacatt
gtcgaaagagaagtcatgcgtcccgttagcccctcggaacaaggctggatggaggtgggt
cagaagggaaaaactgcctacacacgcaccacctcgacctccgagtcacccatcacacgc
atctttggtggcaaacttcgcagcgtcctcaagactcctggtgccaaggacagcgtcaca
ctcgagccgtatcagccgctgcagctcgacatccagcctgcacacgtacagtcgattgaa
gatgcgcttctccatctcaccgagcccgagaccatcccaggagtgtggtcgccttcgcgc
tctgcccaggtggatgctaccaagcaggtctttatcgagtcgcttccgcctgtccttgtt
cttcacctcaagcgattcatctacgacgagattggaggcgtacaaaagagtcagaagccg
ctttcctacggaagcacgctcgagattgcccccgatgtgctcagccccgcgatgcgctcg
cagcctcggccacggtaccgcctgtttggtatcgtctaccaccacggtcgacacgcttcg
ggcggtcactacacggtggatgtgctgcgacaggatgggctctcgtggttgcatatcgac
gacaccttgttctacaacgtggctactgagcacgtggtgcgcaacgcagcctcgaccagc
aaagatcatgctcatgatggtctcgcctatctgcttttctaccggcgtgagctggctggc
gaggcagaagcagcatcggcaccagcgcctgcaccggcggctgcacagccaaacgcggtg
tgcgactcgacgaaatacgcgctccccgatgcgctgttcggcaaccgcgctcctcttgcc
acccgcacacctgcacgcaagcctgcaccggctaagcgcacactgcacaactcggtgcaa
ggcgcaaatgccaacccaggttccgcagcttcgcccgtccaacctcatcccaagctcggc
gcatctgcaccgcagtgcaagcccgccagaaaggctgtgccgggctgggaccgttga

DBGET integrated database retrieval system