KEGG   Ustilago maydis: UM03921.1Help
Entry
UM03921.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
uma  Ustilago maydis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:uma00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    UM03921.1
Exosome [BR:uma04147]
 Exosomal proteins
  Proteins found in most exosomes
   UM03921.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 1682 aa AA seqDB search
MADKPINFSEHVQLTNVGIAAESISFANVTLESENFVCVRENINGQNSVVIVNLNDISDV
MRRPITADSAIMNPVQKIIALKSARQLQIFNIEAKSKVKSHLMQEDVTFWKWISNTTLGI
VTENAVYHWSMEGEATPAKVFDRHVSLQGTQIINYRASQDEKWLVLVGISGNTSGAPNAF
RVKGSMQLYSRDRGVSQPIEGHAAAFAELKSDAAPSPFKLFTFANRTATGAKLHVVEIDH
QNGQPAFTKKAVDVFFPPEATNDFPVAMQVSKRYGIVYLVTKYGFIHLYDLETGACIYMN
RISGDTIFVTAEHESTSGIIGINRKGQVLSVSVDENTVIPYILRTLNNSELAFKLASRGD
LPGADDLYLQQFHSLFSTGQYGEAAKIAANSPRGILRTSQTIEQFKQVPNQPGTLSPILQ
YFGILLEKGSLNKFESLELARPVLNQGRKHLLEKWLKESKIECSEELGDIVRQHDMNLAL
SVYLRANVPNKVVACFAETGQFDKIVLYAKKVGYTPDYAALLQHIVRTNPEKGAEFASSL
VGDESGPLVDVERVTDIFMSQNMIQQATSFLLDALKDNKPEQAHLQTRLLEMNLVNAPQV
ADAILGNEMFTHYDRPRIANLCEKAGLLQRALEHYEDNADIKRVVVHTNLLQAEWLVNYF
GKLTVEQSLECLREMLKVNIRQNLQVVVQIATKYSDLLGPVKLIEMFESFKSFEGLYYYL
GSVVNLSTDPEVHFKYIQAATRTGQIREVERICRESNYYNPEKVKNFLKEAKLSDQLPLI
IVCDRFDFVHDLVLYLYQNMLINFIEVYVQRVNSSRTPQVIGGLLDVDCDEGVIKNLLQS
VSGPIPVDELVEEVEKRNRLKLILPWLQSKIEAGSQDQPLYNAMAKIAIDSNNNPEAFLK
ENNLYDPRVVGKYCEKRDPYLAYIAYAKGFCDDELISITNDNSMFKHQARYLVKRRQLDL
WAQVLTSDNVHRRQLIEQVVSTAVPESTNPDDVSATVKAFMAADLPHELIELLEKIILEP
SAFSDNRSLQNLLLLTAVRTDKGKVMNYIDRLDGYDVDEIAKIAIDHGLYEEAFRIHSKA
EQHEEAMNVLVEHVVSIERGQQYANKLNKPAIWSRLGKAQLDGLRVKDAIDSYVKAEDPS
NYEEVIEIAEHAGREEELIRYLQMARKKAREPKIDTEYAYCLAKANRLGDMEEFLGMTNV
ADILSVGEKCFNDELYEAAKLLFTSVSNYARLATTLVYLGDYQGAVDAARKAGNTSVWKQ
VHAACLSKREFKLSQIAGLAIIPHAEELPGLIRSYEAEGLFDELLTLLEQALGLERAHMG
VFTQTGVALAKYRPERLMEHLKLYWSRSNLPQLIKVAEQCHLWSELVYLYTKYDEMDNAA
LATMEHAAAAWEHDQFKAILPKVANVEIYYRALTFYLEQHPLLLNDLLTVLAKRIDHSRV
VRMFKKKDNDNVPLIRGYLMSVQHHNLEAVNDAYNDVLIEEEDYETLRSSIDGYDNFDTI
SLASRLEKHDLLEFRRLAAHLYKKNERWNESIALSKTDKLFRDAIETAAISGDQAVAEEL
LEYFVEIGNKECYAATLFACYDLVRPDVVMELSWRHGLGDFTMPYQLQSMRDQSERVKKL
EADLSERARLDSEKQKQDDAPIIAPGGLGAPKLITAAVTGLAPAAYPNNLNGGMYMQPTG
MF
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggcggataagcccatcaacttctccgagcatgttcagctcaccaacgtcggcatcgcg
gccgagagcatctcgtttgccaacgtcaccctcgagtccgaaaactttgtttgcgttcgt
gaaaacatcaacggtcaaaactcggtcgttatcgtcaacctcaacgatatcagcgatgtc
atgaggagacccatcaccgccgactcggccatcatgaaccctgtccagaaaatcattgcc
ctcaagtcggcgcggcaattgcagatcttcaacatcgaagccaagtccaaggtcaagtcg
catctcatgcaagaagacgtcaccttttggaaatggatcagcaataccaccctcggtatc
gttactgaaaatgcagtataccactggtccatggaaggcgaagccactccagcaaaggtc
tttgatcgtcacgtcagcttgcaaggtacacagatcatcaactaccgcgcaagtcaagac
gaaaagtggctcgtcctcgtcggaatctcgggcaacacctctggcgctcccaacgccttc
cgtgtcaagggttccatgcagctctactcgcgcgatcgaggcgtctcgcagcccatcgag
ggtcacgccgctgcctttgcagagctcaagtctgacgctgctcccagccccttcaagctt
ttcacctttgccaaccgaaccgccaccggtgccaagctccacgtcgtcgagattgaccac
cagaatggccagcccgcattcaccaagaaggccgtcgacgtcttcttcccaccagaggcc
accaacgacttcccagtcgccatgcaggtcagcaaacgctacggcattgtctatctcgtc
acaaagtatggcttcatccacctctacgacctcgaaaccggcgcctgcatctacatgaac
cgcatctcgggcgacaccatctttgtcactgcagagcacgagtccaccagcggcatcatc
ggcattaacagaaagggtcaggtcctctctgtctcagtcgatgaaaacaccgtcatccct
tacattctgcgcaccctcaataactcggagcttgccttcaagcttgcctcccgtggtgat
cttccaggtgccgacgatctctacctccagcaattccactcgctcttctccacaggccag
tatggcgaggctgccaagatcgccgccaactcgccacgcggcatccttcgaacctcgcag
accatcgagcaattcaagcaggtccccaaccagcccggtacgctctcgcccatccttcag
tactttggcatcctccttgaaaagggctcgcttaacaagttcgagtcgctcgagcttgct
cgccccgtgctcaaccagggccgcaagcatctgctcgaaaaatggctcaaggagagtaag
atcgaatgtagcgaggagctcggtgatattgtacgccaacatgacatgaacctcgcactc
agcgtctatctgcgtgccaacgtgcccaataaggtggtcgcctgctttgctgagacgggt
caattcgacaagattgtcctctacgccaaaaaagtcggctacacccccgactatgccgct
ttgctccagcacattgtccgcaccaaccccgaaaagggtgccgagtttgccagcagcttg
gtcggcgacgaatcaggtcctctggtcgacgttgagcgtgtcaccgacattttcatgagc
cagaacatgatccagcaggccaccagcttcctccttgatgcgctcaaggacaacaagccc
gagcaggcacaccttcaaactcgcctcctcgagatgaacctcgtcaacgctcctcaggtc
gccgatgccatcctcggaaacgaaatgttcacgcattacgaccgtccgcgcattgccaac
ctctgcgagaaggctggtctgcttcagcgtgccctcgagcactacgaggacaatgccgac
atcaagcgcgttgttgtgcacaccaaccttctccaggccgagtggctcgtaaactacttt
ggcaaattgaccgttgagcagtcgctcgagtgtctccgcgagatgctcaaggtcaacatc
cgccagaatctccaggtggttgtccagatcgccacaaagtactctgacctgcttggaccc
gtcaagctcatcgagatgttcgagtcattcaagtcgttcgagggcttgtactactacctt
ggctccgtcgtcaacctgtccaccgaccctgaggtgcacttcaaatacatccaggctgcc
acgcgcaccggccagatccgcgaagtcgagcgtatctgccgagagtccaactactacaac
cctgagaaggtcaagaacttcctcaaggaggccaagctctcggaccagctgccgctcatc
attgtctgcgatcgattcgactttgtccacgacctcgtcctctacctctaccaaaacatg
ctcatcaactttatcgaggtctacgtgcagcgtgtcaactcttcgcgcacaccccaggtc
attggaggtctgctcgatgtcgactgcgatgagggggtcatcaagaacctgctccagtca
gtctccggccctatccctgtcgacgagctcgtcgaagaggtcgagaagcgcaaccgtctg
aagctcatccttccctggctccagtccaagatcgaagccggctcgcaggaccagcccctg
tacaacgccatggccaagatcgccatcgacagcaacaacaaccccgaggctttcttgaag
gagaacaacctgtacgaccctcgtgttgtcggaaagtactgcgagaaacgcgacccttac
ctcgcctacattgcttacgccaagggtttctgcgatgacgagctcatctcgatcaccaac
gacaactcgatgtttaagcaccaggctcgctacctcgtcaagcgacgtcagctggatctc
tgggcccaggtgctcacctcggacaacgttcaccgccgtcagctcatcgagcaggtggtc
tcgaccgctgtccccgagtcgaccaatccggatgacgtttcggctactgtcaaggccttc
atggctgccgacctgcctcatgagctcatcgagctgctcgaaaagatcatccttgagccc
tcggcattcagcgacaatcgcagtctgcagaacctgctccttctcaccgctgtgcgcacc
gacaagggcaaggtcatgaactacatcgaccgtctcgatggctatgacgtcgatgagatt
gccaagatcgccatcgaccacggcctttatgaggaggccttccgcattcactccaaggct
gagcagcacgaggaggccatgaacgtcctcgttgaacacgtcgtgtcgatcgagcgggga
cagcagtacgccaacaagcttaataagcccgccatctggtcgcgtcttggtaaggctcag
ctcgacggactgcgtgtcaaggatgccattgactcgtacgtcaaggctgaggacccttcg
aactacgaagaggttatcgagattgccgagcacgccggtcgcgaggaggagcttattcgc
tacctgcagatggcgcgtaagaaggcccgtgagcccaagatcgacaccgagtatgcctac
tgcctcgccaaggccaaccgtcttggcgacatggaggagttcctcggcatgaccaacgtc
gccgacatcttgagtgtcggtgaaaagtgctttaacgatgagttgtacgaggctgctaag
ctcttgttcaccagcgtatccaactatgcgcgtctcgccacgacgctcgtctaccttggc
gactaccagggcgccgtggatgcggctcgcaaggcgggcaacacgagcgtgtggaagcag
gtacatgctgcgtgtctcagcaagcgtgagttcaagctttcgcaaatcgccggtctggct
attatccctcacgccgaggagctgcctggtctgattcgatcgtacgaggccgagggcttg
tttgacgagttgctcaccttgctcgagcaggcgctgggtctcgagcgtgcacacatgggt
gttttcacgcagaccggtgtcgcactcgccaagtaccgcccggaacgtcttatggagcac
ctcaagctgtattggtcgcgctcgaacctgccgcagctcatcaaggtggccgagcagtgt
catttgtggtcagagctcgtctacctttacacaaagtacgacgagatggacaacgcggca
cttgccaccatggagcacgccgctgctgcgtgggaacacgatcagttcaaagccattctg
cccaaggtggccaacgtcgagatctactaccgtgcgctgacgttctacttggagcagcac
ccgttgttgcttaacgatctgctcaccgtattggccaagaggatcgaccacagcagggtg
gtgcgtatgttcaagaagaaggacaatgacaacgtaccgctcatacggggctacctcatg
tcggtgcagcatcacaatctggaagctgtcaacgatgcgtacaacgacgtgttgatcgag
gaggaagactacgagacgttgcgatcgtcgattgatggatatgacaactttgacacgatc
tcgctggcgtctcgcttggagaagcacgatctgctcgaattccgtcgattggcggctcat
ctgtacaagaagaacgaacggtggaacgagtcgattgcgctctccaagacggataagctg
tttcgcgatgcgattgagacggcagcgatttcgggcgatcaagcagtggcggaagagttg
ctcgagtactttgtcgagatcggcaacaaggagtgctatgctgcgaccttgtttgcatgc
tatgatctcgtgcgtccggatgtggtgatggagttatcctggcgacacggcctcggcgat
ttcaccatgccgtaccagctgcagagcatgcgcgaccaaagcgagcgcgtgaaaaaactc
gaagccgacctcagcgagagggctcgactcgattccgagaagcagaagcaagacgacgct
ccgatcatcgcacctggcggactcggcgcacccaagctcatcaccgcagccgtcaccggc
ctcgcccccgctgcctacccgaacaacctcaatggtggcatgtacatgcagcccaccggc
atgttctaa

DBGET integrated database retrieval system