KEGG   Ustilago maydis: UM04015.1Help
Entry
UM04015.1         CDS       T01021                                 

Definition
similar to AF502086.1 steroid 5alpha-reductase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     UM04015.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 388 aa AA seqDB search
MSILTWIKDVIGLGTLPSPPYSPAQLYSIVLASFKAWPFLIPVLSLINAPHGRFAFDSLL
NINGNLGWFIMEIPSPIFVLLGALSKPLSASVVKGSGEIFPPLSELFSPSIKHFLALPSA
NQVLVVMFLIHYSHRAVLQPLRSPKRSPLHISVPLSAVAFNLINGFVMGSWLGGRTPWSA
LPQPAVASAALAAVSAKAGNTASALAASELTRKLISTGAADAVGIDAPGLISNSVWKSPL
WYLGLAGWAIGFAGNVMHDEILMNIRKPNKQAQSFQKRFDDKTSVCKGTSKYSIPRGGMF
EYISFPNYLCEWFEWLSFAFAAIHSLPIFTHLSIKDAIATALSTPPCLFPFVLICLMAPR
ATNGHKWYKRTFGDKFPRERKAIIPFVF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcctcacctggatcaaggacgtgatcggtttgggcacgctgccgagcccacct
tactcgccagctcaactctactcgatcgtgctggcgagtttcaaagcgtggccgtttctc
atacctgtcctatcgctcatcaacgcgcctcatggcaggttcgcgttcgatagcctgctc
aacatcaacggcaatctgggctggtttatcatggagattccttcgcccatctttgtgctg
cttggtgcgctctccaagccgctctcagcttcggtggtcaaaggatccggagaaatcttt
ccgccgttgtcggagctcttctcgccttcgatcaagcatttcttggctctgccatcggcc
aatcaggtgctggtggtgatgttcttgattcactactcgcatcgtgccgtgttgcagcca
ttgaggtcgcccaagcgctcgccgctgcatatttcggtgccgctgtcagcagtggcgttc
aacttgatcaatggcttcgtgatgggtagctggcttggtggaaggactccctggtccgca
cttccgcaacctgccgttgcttcggctgctctcgccgctgtcagcgcaaaggcaggcaac
acagcttcagcacttgctgcgtcagagctcacgcgaaagctcatttccacaggagccgca
gatgcagtgggaatcgatgcacctggtcttatctcgaattcggtgtggaagagccccctc
tggtatttgggtctggcaggctgggcgatcgggtttgccggaaacgtcatgcacgacgaa
atcctgatgaacattcgcaagcctaacaagcaagcgcagtcattccaaaagcgcttcgac
gacaagacgagtgtgtgcaaaggcacttccaagtactcgatcccgcgcggaggtatgttt
gaatacatttcattccccaactacctgtgcgaatggttcgagtggctctcatttgcattc
gccgccatccactcgttgcccatctttacccatctcagcatcaaggacgccatcgcaaca
gcactttcgacaccaccctgtctctttccctttgtgctcatttgccttatggctcctaga
gctaccaacggtcacaagtggtacaagaggacattcggcgacaagttcccacgcgaacgc
aaggcaatcatcccttttgtcttttaa

DBGET integrated database retrieval system