KEGG   Ustilago maydis: UM04064.1Help
Entry
UM04064.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
uma  Ustilago maydis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:uma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 547 aa AA seqDB search
MTTNMDTLESKRAATESTPLLCSTHASHKCASYPWLAQGADSEDMTRSTESRVARIRIAL
LSSGGLCLLLIWFCALSSNVDAAWIVKLVIGQQSSARASHLASRSVSSTYAYQRMLANIG
GASSTVGDNQVPNVETGAVIASPSTAHPDYLYSWVRDAALTIKVVISQPTLDRTLVTNYA
NAEYTHQQNAARSAAGQGEPKFNVDGSLFTGAWGRPQNDGAALRASALMAFAKRIGLNDS
FTTGTLYKRELGSPSLIKTDLEYVAHHWQDSSFDLWEEVEGAHFFTLIVQWRSMVDGAKF
ASAINDAGAASYYDQQAAEMLVKLQSFWDADKGYVQAYQGVGNRDGIDCSVLLGSLKGWD
TTDYNAAVNATLFGPASDKVLATHKKYVDAFRSMYAINGGAAAPAAVATGRYPSDVYDGD
GTSQANPWYICTLAAAEVLNTALSIVRARGSLEITSTSLAFYRQFASSATTGSFSSTSDQ
YITLTTAIKRMADGFVQIVNQHAWHNGSLNEQFNRNTGFNQGARDLTWSYAAFVTNDWAS
HNMFLVT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaacatggacacgctcgagagcaaaagagccgctactgaatcgacgcctctt
ctgtgctcgacgcatgcatcccataaatgtgcctcctacccctggcttgcacaaggcgcc
gatagtgaagacatgactcgttcgaccgaatcgcgtgtcgcgcgcatccgcatcgctctg
cttagcagtggcggtctgtgcctactgctcatctggttctgcgcgttgagcagcaatgtt
gacgcggcttggatagtcaagttggtgatcgggcaacagtctagcgctcgtgcttcacac
ctcgcttcacgttctgtcagttcgacgtacgcgtaccagcgtatgttggccaacatcgga
ggtgcctcgtccacggtcggcgacaatcaagtgcctaacgtcgaaacgggcgctgtgatc
gcctcgccttccactgcacatcccgactacttgtactcgtgggtgcgcgatgcagctctc
accatcaaggtggtcatctcacagccgacactcgaccgaacgctggtgaccaactatgcc
aatgccgaatacacgcaccagcaaaacgcagccagatcggctgcaggccaaggcgaaccc
aagttcaacgtcgacggttcgctcttcacgggtgcatggggaagacctcagaacgacggc
gctgcgttgcgcgcttcggctctgatggcgttcgctaagcgcatcggcctgaacgacagc
ttcacaacaggtacactgtacaaacgcgagctaggctcgcccagcttgatcaagaccgac
ctcgagtacgtggcgcaccactggcaggattcgagctttgatttgtgggaggaagtggag
ggtgcccactttttcacactcatcgtacagtggaggagtatggtggatggcgccaagttt
gcaagtgcgatcaacgatgcgggtgcggcgagctactacgaccaacaggcggcggaaatg
ctggtcaagctgcagtcgttctgggatgcagacaagggttatgtgcaggcgtaccaaggt
gttggcaacagagatgggatcgactgttccgtgctgcttggctcactcaaggggtgggat
acaacagactacaacgcagctgtcaacgcgacgcttttcggacccgcttcggacaaagta
ctggcaacacacaaaaagtatgtggatgcattccgatcaatgtacgcgatcaacggcggc
gctgctgctcctgcagcggtggccacagggcgctacccatcagatgtctacgacggcgat
ggaacgtcgcaagccaacccgtggtacatctgtacgctcgctgctgccgaagtgctgaat
acggcgctcagcatcgttcgcgctcgtggcagtctggaaatcacctcaacttcgctggcg
ttctaccggcagttcgcctcgtcggccactacaggaagcttctcctcgacctcggatcag
tacatcaccctcactaccgccatcaagcgtatggctgatggatttgtgcagatcgtcaac
cagcacgcttggcacaacggcagcttgaacgaacagttcaaccgcaacaccggcttcaac
cagggcgccagagatttgacctggtcctacgccgcattcgtcacaaacgactgggcaagt
cacaacatgttcctcgtaacctag

DBGET integrated database retrieval system