KEGG   Ustilago maydis: UM04236.1Help
Entry
UM04236.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
uma  Ustilago maydis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UM04236.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     UM04236.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 1159 aa AA seqDB search
MLLTRTASRLQCLPRPAVTPNKALSSSTRALATVTDKKYIAVLGGGISGLTSAYRLAQHL
PKDRYNIVLLEHQNRLGGWIRSERIVLPTADGAAQNVTALIEQGPRSIRPAGYSGLMMLE
LVRSLGLLERMLKVPKTAPSAQNRYLYYPDRLAKLPSSIPSLLSALFKLPFLRAIIPGVL
REPRVPSRFLRPRSESKSEKQRLQQREWIQDESVDSFVSRRFGNGLAENLVSAVIHGIYA
GDTRKLSIRAVLPFLWEAERVHGSVLRSMLSTKRNKRHRALPEPEAAVKAAKDLRLENIE
KELGKDVVESFKSISVYSFQEGVQEIVQALESRLAEYDNVQIKKGDAVQSIHRNEAGKTT
LHTESGETMVVDRIISSIPSTRLAQILPSDAELPHLSHNPSANVGVVNLVISPSAVASSS
KPLVPVEGFGYLIPRTSPGNQDGILGVVFDSDAIPEQDSVCAASRPVKLTVMMGGSHWAD
LETLPSEADMRARAINAVSQHLGIDRSLLEDASKVSVRATMQKDCIPWYLVGHPVRMSQL
HKALEKDELLGSKLTLVGASYTGVSLNDCVAYATEAVEQIVDAELHGGERIVTGLASFAI
PPVPPSQKATSITAQARKGDTRPSVNPQGLMGPITGTPNQFAVAGSIHTRAFSTTRQKSN
SSSSSSSSSRSTPVSSADKKTKSLNEILLDSIRASGPMPVSTYMRTCLLDPMQGYYSSAN
SPSTSREVLGSRGDFITSPEISQVFGELVAIFYLARWQSVGAPSATRIVELGPGKGTLLA
DMLRTFATFKPFMATLKRIHLVETSEGLMELQLNAIKEALGVVGKRVVSAEEDAGADGVV
VEWFPGIDMVPVIPEELTILTAHEFFDALPTHIFEKGVDGKFREVLVGIKPTSSITVLKP
GQDLQKQAQNEELGFVLSPTPTPWAQMLVQNNPRFQHLEPGQRVEVSPEAWAVARRVGEI
VAGRSASAPSSPKQEAPRSAPEGSAEAKAEAALEAERLQAERRLETQRLSHATEGGIGLI
IDYGDDKAYGSSLRAFKNHALVRVFDSPGTVDLTVNVDFLHLKSAIHTTDARYLGPIDQA
DFLVGMGLQMRTEALVKGRDAHDENRIKDAANRLIDESGMGIQYKALAITARRCAENNAP
DQHRDKVADPDIYPFEFQH
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttacaagaacagcgtcacggctgcagtgcttgccgcggccggcagtgacccca
aacaaggctctctcgtcctcgacaagagcgctcgcaacagtcacagacaagaaatacata
gctgtgcttggcggtggtatctctggtctcacctctgcatatcgtcttgctcagcatcta
ccaaaggatcgatacaacattgtccttctcgaacatcagaatcggctcggtggatggatt
cgatccgaacgcatcgttcttccaactgcagacggagccgctcagaacgtcacggcgctg
atcgaacaaggtccacgcagcattcgacccgccggctactctggtttgatgatgcttgaa
cttgttcgatcactaggactgctcgagaggatgctcaaggttccaaagacggcgccgtca
gcacagaatcgatacctttactacccggatcgactcgcaaagcttcctagcagcatccct
tccctcttgtccgcgctcttcaagctacccttcctgcgtgccatcattcctggcgtgctg
cgcgagccccgtgttccttcccgcttcctgcgtccacgctccgaatccaagtctgaaaag
cagcgtctgcaacaacgagagtggatccaagacgaaagcgtcgattcgtttgtctcgcgt
cgttttggtaatggtctcgccgagaacctcgtttcagccgtgattcatggaatttatgcc
ggtgatacgaggaagctcagcatccgcgctgtccttccattcctatgggaagctgaacga
gtgcacggcagtgtgctgcgcagcatgctgtctaccaagagaaacaagcgtcatcgagcc
ttgccggaaccggaggcggccgtcaaggcggcgaaagacctgcgtctcgagaatattgaa
aaggagctgggtaaggatgtggtcgaaagtttcaagtcgatcagcgtctacagcttccaa
gaaggcgtgcaagagatcgttcaggcgctcgagtcgcgtttagcagaatacgacaatgtg
cagattaagaaaggtgacgctgttcagtccatacaccgtaacgaagcgggcaagaccact
cttcatacagaaagcggtgagacaatggtagtggatcgtatcatttcgagcattccctca
acacggctcgcacagattcttccatctgacgcagagctgccgcatctcagccacaaccca
tctgcaaatgtgggcgttgttaacctcgtgatctcccccagtgctgtcgcatcatccagc
aagcctttggttcccgtggaagggttcggatatcttatcccacgcacgtcaccaggaaac
caagatggcattctaggcgttgtttttgacagcgatgctattccggagcaggattccgtg
tgtgctgcttcacgaccggtcaagttgaccgtcatgatgggtggctcgcattgggcggat
ctggaaacgctcccaagcgaggcggacatgagagcgcgcgctatcaacgctgtttcccag
catcttggaatcgatcgttccctgctcgaagacgcatcgaaagtcagtgtcagggcgaca
atgcagaaagactgcattccatggtacctagtcggccacccggttcgaatgtcgcagttg
cacaaggcgctggagaaggacgagctgttaggcagcaaactgactcttgtcggcgctagc
tacactggcgttagtttgaatgactgcgtggcctatgcgacggaggcagtagagcagatt
gttgacgcagaactgcacggtggggagcggatcgtgactggtctcgcttcttttgccatc
cctcctgttcccccgtcgcagaaagcaactagcatcactgctcaggcgaggaagggcgac
acacgccccagcgtcaatcctcaaggtttgatgggtcccatcacgggaacacctaatcag
ttcgctgttgctggcagcattcacacacgggccttttcgaccactcgtcagaagtccaac
tcttcttcgtcgtcatcgtcttcttctcgttccacgcctgtcagctctgcagacaagaaa
acaaagagcctcaacgagatcctgctggacagcatccgtgcctctggacccatgcccgtc
tcgacatacatgcgaacttgcctcctcgatccgatgcagggctactattcgtctgcgaat
tctccgtctacatcacgcgaggtgcttggcagcagaggcgactttatcacttctcccgag
atctcgcaagtgtttggcgagcttgtcgccatcttctacctggcacgatggcagtcggtt
ggcgcaccatcagcaactaggattgtagagctcggtccgggtaaaggaacgttgctagcg
gatatgctgaggacgtttgcaacattcaagcctttcatggcgacgttgaagcgcatacat
cttgtcgagactagcgagggcttgatggagcttcagctaaacgcgatcaaagaggctctt
ggtgtagtcggaaagagagtggtgagcgcagaggaagatgctggagcagacggtgtggta
gtcgaatggtttccgggtatagacatggtgccggtgattccggaagagttaacgatcctc
acggcgcacgagttctttgatgctttgccaacgcatatctttgaaaaaggagtggatgga
aagttcagagaagtgttggtgggcatcaaacccacgtctagcattacagtgctcaagccg
ggccaagacttgcagaagcaagcccagaacgaggagcttggatttgtgctcagccccaca
ccgacgccatgggcgcagatgctggtgcaaaacaatccacgtttccaacatcttgagccg
ggacagcgggtggaggtgagtccggaagcctgggcggtggcgcgaagggtgggggagatt
gttgctggccgatcggcgtctgctccgtcttcgccaaaacaagaagctcctcgttcagca
cccgaaggctcggcggaggctaaggcagaagcagcactcgaagccgagcggttgcaagca
gaacgtcgcttagaaactcagcgactctcgcacgccaccgaaggaggcatagggctaatc
atagactacggagacgacaaagcttacggatcatcgttgcgtgcattcaagaatcacgcg
ctcgtccgcgtcttcgactcccccggtacagtcgacctgacagtcaacgtggatttcctg
catctcaagtcggcgatccacacaacagacgctaggtatcttggccccatcgaccaggcc
gacttcctcgtcggcatgggtctccagatgcgtaccgaggcgctcgtcaaaggcagagac
gcgcacgatgaaaacaggatcaaagacgccgctaacagactgatcgacgaatccggtatg
ggcatccagtacaaggcgttggccatcaccgccaggcgttgcgccgaaaacaacgcacca
gaccagcaccgcgataaagtcgccgatcccgatatctacccatttgagttccaacactag

DBGET integrated database retrieval system