KEGG   Ustilago maydis: UM04299.1Help
Entry
UM04299.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
uma  Ustilago maydis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:uma03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 745 aa AA seqDB search
MPSVDEITNGVDELDFVDDADIDFSDIEQKYSVKFDEGLDDVIVIEGVPVITESRQQKLF
ETIQKRFKTHANIDIAVEGMHIPYADNGESKGYIFVEMASAEDAAQAIRQMDGYAFDKKH
RFSVHRFTDVEKFASLSETYEEPQEEEFKPREHLRSWLADPAGRDQLVICRGDDVEIAWH
NRSSDPQVEHSRPRWTESYVQWSPLGTFLTTFHRQGIQIWGGPSCERFMRFPHPGARLVD
FSPSEKYMVTWSHEPIQVPDNAPIGPQFFGPEDEGNRIAVWEVRTGHLLRSFPVPQDESG
QPGQLKGFSWPFLKWSPDDKYCARLNPGQAISVYETPSMGLLEKKSIKIEGVVDFEWCPM
GDKDRELAEAAKPNKKARDNMIVYWQPEVANQPARVTVMAVPSRTILRSKNLFNVSDCKL
HWHPQGDYLCVKVDRHTKTKKSMFCNLEIFRVREKEFPVEVVELKDAVTAFAWEPFGTHF
ALISSNDPQLGTPASGITIKTQLNFYHLHPKGDFRPLKVFDNKTANTLFWSPRGRHIVVA
TLGSSQKFDLEWYDVDFMHEVRQGNPSADPADDVKLIGTGEHYGITDLEWDPSGRYVATS
ASVWRHSLENGFAIWDFKGQELQKHIQDRFKQILWRPRPRTLLGKDEQKRVRKNLREYSK
QFEEEDAAEESNLASAERELYQRILEEWKAWRARSRRDLEQLRADLGREEVGQSVDHAKK
LAEEATEEVQEWMEEIIEETEEVLA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgtagacgaaatcaccaacggtgtcgacgagctcgactttgttgacgatgcc
gacatcgacttttccgacattgaacaaaagtactcggtcaagttcgacgaaggcctcgac
gatgtcatcgttattgagggcgtccccgtcatcaccgagtcgcgtcaacagaagctgttc
gagacgattcagaaacgtttcaagacgcatgccaacattgacattgccgttgagggcatg
cacatcccttatgccgataacggagagtccaagggctacatctttgtcgagatggcttct
gccgaagatgccgctcaagccatccgtcagatggacggctacgcctttgacaagaagcac
cgcttctctgtccatcgattcaccgacgtcgagaaattcgccagcctttccgagacctac
gaagagcctcaggaggaagagttcaagcctcgtgaacaccttcgctcctggctagctgac
cctgctggtcgtgatcagttggttatctgccgtggtgacgacgtagagatcgcttggcac
aatcgctcatcggatcctcaggtcgagcacagccgtcctcgctggacagaaagctacgtc
cagtggtcgcccctcggtactttcctcaccaccttccaccgtcaaggtattcagatctgg
ggtggaccctcatgcgagcgcttcatgcgtttccctcatcccggagcgcgtctggtcgac
ttttctcccagtgaaaagtacatggtcacctggtcgcacgagcctatccaggttcccgac
aatgctcccatcggtcctcagttctttggtcccgaagacgagggcaaccgcatcgccgtc
tgggaggtccgaaccggtcacctcttgcgtagcttccccgtgcctcaggacgagagcggc
cagccaggtcagctcaagggcttctcctggcccttcctcaaatggagccccgatgacaag
tactgcgctcgtctcaacccgggtcaggccatcagtgtatacgagaccccctccatgggt
ctgctcgagaaaaagtcgatcaagatcgagggtgttgtcgactttgagtggtgtcccatg
ggcgacaaggatcgcgagcttgccgaggctgctaagcctaacaagaaggccagggacaac
atgattgtatactggcagcccgaggtggccaaccagcctgcacgtgtcactgtcatggct
gtaccatcaagaaccatcctgcgttccaagaacctctttaatgtctcggattgcaagctg
cactggcatccgcagggcgactacctctgtgtcaaggtcgaccgacacacaaagaccaaa
aagtccatgttctgcaacctcgaaattttccgcgtgcgagaaaaagagttccccgtcgag
gttgttgagctcaaggacgctgtcactgcttttgcgtgggagccgttcggaacccacttt
gcccttatctcgagcaatgacccccagctcggtacaccggcatctggtatcacgatcaag
acgcagctcaacttttatcacctccaccccaagggcgacttccgtccgctcaaggtgttt
gacaacaagacagccaatacgctcttctggtcgcctcgtggtcgtcacatcgtcgtcgca
acgctcggcagctcgcaaaagtttgatcttgagtggtacgacgtcgacttcatgcatgaa
gtccgacagggcaacccctcggctgatccagctgacgatgtcaagcttatcggcacgggt
gagcactacgggatcactgacctcgaatgggacccctcaggtcgctatgtagccacttcg
gcttcggtctggcgacactcgctcgaaaacggcttcgccatctgggacttcaagggccag
gagctgcaaaagcatatccaggaccgcttcaagcagatcctttggcgcccgcgaccccgt
acgcttcttggtaaagacgagcagaagagagtgcgcaaaaacctgcgagaatactccaag
cagttcgaggaggaggacgccgccgaggagtccaaccttgcttcggccgagcgcgaactg
taccaacgcatcctggaggagtggaaggcatggcgtgcacgatcccgtcgcgacctcgag
cagctgcgcgcagatcttggtcgcgaggaggtcggccagagcgtcgaccacgccaagaag
cttgccgaggaggccaccgaggaggtgcaagaatggatggaggagatcattgaagagacg
gaggaagtgctcgcctag

DBGET integrated database retrieval system