KEGG   Ustilago maydis: UM04341.1Help
Entry
UM04341.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
uma  Ustilago maydis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UM04341.1
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM04341.1
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    UM04341.1
Enzymes [BR:uma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     UM04341.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 623 aa AA seqDB search
MPKTVHIFRSTPRTNQSSKRARQRKLLQLHSTQVNIALHQTSTTASASPFSPHADMKYLS
TRGGSERLTFEEAVLTGLAPNGGLFIPQEIPQLPANWQSEWADLSFSELSHRVLSLYIPQ
DPAEGGIPSADLQQVINKSYATFRHKDITPLVRLDDKEWCLELWHGPTFAFKDIALQLLG
NLFEYFLQRRNNGKPAEQREKLTIVGATSGDTGSAAIQGVRSKQDISIFILFPHGRVSPI
QEAQMTTVLDDNVHNVSVQGTFDDCQDVLKALLSDAEFNAKHRLGAVNSINWARILAQIV
YYFAAYFSFRKQLGLSASQSTPKDLEFVVPTGNFGDILAGYYAKRMGLPVSRLVVATNEN
DILQRFWATGRYEKSSAASSSSAASSAQTEPANGSSDGAQQGGVRATLSPAMDVLISSNF
ERLLWYVAYESQAPSNADASEQEKQEAAGQQLASWMQSLKTEGRIAVDEAQLAIARRDFA
AERVSDQEIRETVLQYFVRKPTAAYPAGSYLVDPHTAVGFKAAANASSTSSNAHQIVLST
AHPAKFAEAVTSSLESAGADFDFERDVLPKEMVGLLEKERRVIHVKPQGKPGVEGLVNAV
KDVVEKQAEVVKARAPSANTASV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaccgtgcacatcttcagatcgactccgcgaaccaaccaatcatctaaacgt
gcaaggcaaagaaagctgcttcaattacactccactcaagttaacattgctttgcatcaa
acatcgaccacagcctcagcctctccattttctccacacgcagatatgaagtacctcagt
accaggggcggttccgagcgcctcacgtttgaggaggccgttcttaccggtctcgctccc
aacggaggtcttttcatccctcaagagattccacagctgcccgccaactggcagtctgaa
tgggccgacctttccttttccgagctttcgcatcgcgtcctctccctttacattcctcaa
gacccagcagaaggcggcattccttctgccgatctccagcaggtcatcaacaagtcgtac
gccacgttccgacacaaggacatcacaccgctcgtacgattggatgacaaagaatggtgt
ctcgaactctggcatggccccacatttgcgttcaaggatattgcgcttcagcttctcggc
aacctgtttgaatactttttgcagcgaagaaacaacggcaagccggctgagcagcgtgag
aagctcaccatcgtaggtgctaccagtggtgacaccggtagtgctgctatccagggtgta
cgatccaagcaagacatctcgatctttattcttttcccccatggccgtgtcagccccatt
caggaagcgcagatgactactgtgctcgacgacaatgtccataacgtttccgtccaaggc
acatttgacgactgccaggacgtcctcaaggcgctcctctctgacgccgaatttaacgcc
aagcaccgtttgggtgccgttaactcgatcaattgggcgcgtatccttgctcagatagtc
tactacttcgccgcatactttagcttccgcaagcagctcggtttgtctgcttcccagtct
acacccaaggatctcgaatttgtcgttcccacgggcaactttggtgacattctcgctggc
tactatgccaagcgaatgggtctacccgtctcgcgactcgtcgtggctaccaacgagaac
gatatcttgcaacgattctgggccaccggccgatacgaaaagtccagtgctgcttcatcc
tcctcggcggcttcctcggcacagaccgagccggcaaacggttcttccgatggtgctcag
cagggcggtgttcgagccacgctttcgcccgccatggatgttctgatctcttccaacttt
gaacgtttgctctggtatgttgcttacgaatcgcaagctccctccaacgccgacgcctct
gaacaagaaaagcaagaggccgcaggacaacaacttgcgtcgtggatgcagtcgctcaag
actgaaggtcgcatcgccgttgacgaagcacagctagccatcgcccgccgtgattttgcc
gctgaacgagtttccgaccaagaaatccgcgagaccgtgttgcagtactttgtccgaaaa
cctactgctgcctaccctgctggttcgtacctcgtcgacccgcataccgctgttggattc
aaagccgccgcgaatgcgtcgagcacctcgtccaacgcacaccagattgtactgtccact
gcgcatcccgccaagttcgccgaggcggttacttcgagtttggagagtgcaggtgcagat
tttgatttcgagcgcgatgtcctgccaaaggaaatggttggtttgctggaaaaagaaagg
agagtgattcatgtgaagccccagggcaaacccggtgtagaagggctggtaaacgcggtc
aaagatgtggtcgaaaaacaggccgaagtggtcaaggctcgtgcgccatctgctaacact
gctagtgtataa

DBGET integrated database retrieval system