KEGG   Ustilago maydis: UM04456.1Help
Entry
UM04456.1         CDS       T01021                                 

Definition
similar to vinclozolin resistance protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
uma  Ustilago maydis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    UM04456.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     UM04456.1
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   UM04456.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 405 aa AA seqDB search
MSAIPQQPVDYSATHEAAVAAAAAAAAKAATATAGGGASSSQHPAPAVVGATSVPTHVAS
ANSTGTYSSASLPLAIAAQQRKLSGRYALTDFAVERTLGTGSFGRVHLVRSRHNHRFYAI
KVLRKEQVVKMKQVEHTNSERAILSIVRHPFLVNLWGTFKDSTFLYMVMDYVPGGELFTL
LRKSQRFPHPVAKFYAAEVALAIDYLHQNNIIYRDLKPENILLSADGHLKITDFGFAKYV
PDVTWTLCGTPDYLAPEIVSSKGYNKSVDWWALGVLLYEMLAGHPPFFTEDGNPIKLYEK
IIACKVRYPPYFETGVKDLLKNLLTADLSKRYGNLHRGSKDIFGHLWFAEVDWDRLYRRE
IPAPYLPTVTADGDSSQFERYPENDVTEYSRTDLPDSLGHLFPDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctattccacaacagcccgtcgactattcggccacacatgaagcagctgttgct
gctgctgctgctgcagcagcgaaagcagcgacagcgacagcaggaggtggggcgtcgtca
tcacagcatccagcaccagcggtagtcggcgctacatctgtgcccacgcacgtcgccagc
gccaactcaacaggtacttacagctcggcgtcgcttccactcgcgattgctgctcagcaa
cgcaaattgagcggtcgatacgccttgactgatttcgcagtagagcgcacattgggcacg
ggcagtttcgggcgtgtgcatctggtgcgttcgcgccacaaccaccgcttctacgcgatc
aaggtgttgcgcaaggagcaggtagtcaagatgaagcaggtcgaacacacgaattcggaa
cgtgcgatcctttcgatcgttcgccatccgttcctcgtgaatctgtggggcacgtttaaa
gactcgactttcctgtacatggtcatggactacgtaccaggcggagagctgttcacgctt
cttcgcaaatcacaacgcttccctcacccggtcgcaaagttctacgccgccgaagtggcg
cttgcgatcgactacctccaccagaacaacatcatctaccgcgatctgaaaccggaaaac
atcctcctgtctgcggacggacatctcaagatcaccgactttgggtttgcaaagtacgtg
cccgatgtcacgtggactctttgtggtacaccagactacctggcgcccgagatcgtgtcg
agcaaaggctacaacaagagtgtcgactggtgggcgctcggcgttctgctgtacgagatg
ctcgccggtcatccgccgttctttaccgaggacggcaatccgatcaagctgtacgaaaaa
atcatcgcttgcaaggtcaggtatccgccctactttgaaacgggcgtcaaggatctgttg
aagaacctgttgactgcggatctcagtaagcgctatggtaacttgcataggggaagcaag
gatatctttggtcacctgtggtttgcagaggtcgattgggataggttgtatagaagagaa
atcccggcgccttacctgcccaccgttaccgccgatggcgactcgagccagtttgaacgc
tatcctgaaaacgatgtgaccgaatacagtcgcactgatctccccgatagcttgggccat
cttttcccggatttctga

DBGET integrated database retrieval system