KEGG   Ustilago maydis: UM04470.1Help
Entry
UM04470.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
uma  Ustilago maydis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UM04470.1
Enzymes [BR:uma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     UM04470.1
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UM04470.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 699 aa AA seqDB search
MAAATTSAAAQAPAPIDYSKATDGTGVIALDPWLEPFAPALRERYGVYADWVKRINASEG
GLEAFSRSYRKMGFQIDPTTQAVTYTEWAPNAVQASLVGDFNNWSRDAHPMSKDDFGKWH
ITIPPLAKGQCAIPHDSKIKVSFVLPSGERIERLPAWILRVTQDLNVSPVYDARFWNPAK
QDRYTMRFPKPPKPDNIKVYEAHVGIATPEARVGQFKEFTKNVLPRIKELGYNTIQLMAI
QEHAYYASFGYQVTNFFAASSRYGNPEDLKELIDVAHSLGITVLLDIVHSHACKNVLDGL
NMFDGTDHLYFHEGGKGRHELWDSRLFNYGHHEVLRFLLSNCLFWMEEYGFDGFRFDGVT
SMLYTHHGIGTGFSGGYHEYFGPSVDVEAVVYLMLANQMIHEYNPKAITIAEDVSGMPAL
CRPVSEGGVGFDYRLSMAVPDMWIKLLKETSDEDWDFGNICFTLTNRRHLEKSIAYAESH
DQALVGDKTLAFWLMDKEMYTNMSDLTERTQVIDRGLALHKMIRLITHALGGEGYLNFIG
NEFGHPEWLDFPREGNGNSFHYARRQFNLVDDQLLRYKYLYAFDAAMNKAEEKYKWLAAP
QAYISLKHDSDRVVAFERAGLLFVFNWHADKSYTDYRIGVDVPGKYRVLLDTDQASLGGH
ARLDHATEYFSTDMAWNGRSNFVQLYLPSRSAIVLYRAG
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctaccacatccgctgcggcccaagcgcctgcacccatcgattattccaag
gccaccgatggcactggcgtcattgcgcttgatccatggttggagcccttcgcacctgct
ctgcgcgagcgatatggcgtctacgcggactgggtcaagaggatcaacgcttccgaaggc
ggccttgaagccttctcgcgctcctaccgcaagatgggcttccagatcgaccccaccacg
caagccgtcacctacaccgaatgggcacccaacgcagtgcaagcttcgcttgtcggcgac
ttcaacaactggtctcgcgatgcacacccgatgtccaaggacgactttggaaagtggcac
atcaccattccaccgttggcaaaggggcagtgcgccatcccgcacgactccaagatcaag
gtctcgttcgtactaccctcgggtgaacgcatcgagcgtctgcctgcatggatcctgcga
gtgacgcaggacctcaatgtttcgcctgtctacgatgctcgtttctggaatcctgccaag
caagatcgctacacgatgcgcttccccaaaccacccaagccggacaacattaaagtgtac
gaagcgcacgttggcatcgctactcccgaagcgcgagtgggtcagttcaaagagtttacc
aaaaacgtgctgccacgcatcaaggagctcggctacaacacgatccagctcatggcgatt
caggagcacgcctactacgcgtcattcgggtaccaggtcaccaactttttcgctgccagc
agccggtatggcaacccggaagacctcaaggaattgatcgacgtagcgcactcgctcggt
atcacagttctgctcgacattgtgcactcgcacgcgtgcaaaaatgtgctcgacggtctc
aacatgttcgacggtaccgaccacctctacttccacgaaggcggcaagggacgccacgaa
ctttgggactcgcgcctgttcaactatggtcaccacgaggtgctgcgcttcctgctgagt
aactgcctcttctggatggaggagtacggctttgacggtttcaggtttgacggcgtcacc
tcgatgctgtatacgcatcacgggatcggcacgggattcagcggtggctaccacgaatat
tttggaccttcggttgacgtagaggcggtcgtctatctgatgctcgccaaccagatgatt
cacgagtacaacccgaaagcgatcacaatcgctgaggacgtttcggggatgcctgcactg
tgccgacctgtctcggaaggcggtgtgggttttgactatcgcctgtcgatggctgtgccg
gacatgtggatcaagctgctcaaggaaacgtcggacgaagactgggatttcggcaacatc
tgcttcacgctcaccaatcgacgacatttggaaaagtcgatcgcatacgctgaatcgcac
gaccaggcgctcgtgggggacaaaacgttggcgttttggttgatggacaaggagatgtat
accaacatgtcagacctcaccgaacgcacgcaggtgattgatcgcggcttggcgttgcac
aagatgattcgtctgatcacgcatgcgctcggcggcgaggggtatctcaactttatcggc
aacgaatttggacatccggaatggcttgattttcctcgcgagggcaatggcaactcgttc
cactacgcacgtcgtcaattcaacctggtcgacgaccagctgctccggtacaagtacctg
tacgcgtttgacgctgccatgaacaaggcggaggaaaaatacaagtggcttgccgctcct
caagcgtacatatccttgaagcacgactcggatcgcgttgttgcgtttgaacgtgccggt
ctgctgtttgtctttaactggcatgccgataagtcgtacactgattatcgcatcggtgtc
gacgtgcccggcaagtatagggtgctcctcgataccgaccaggccagcttgggcggccac
gcgaggctcgaccatgccaccgagtacttctctaccgacatggcgtggaatggcaggagc
aatttcgtgcagttgtacctacctagcagaagtgccattgtcctctacagggccggttga

DBGET integrated database retrieval system