KEGG   Ustilago maydis: UM04543.1Help
Entry
UM04543.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     UM04543.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 689 aa AA seqDB search
MATVVPRAKKQRTLPDQLIGLTPSSLQGVDPISVSSSMLAHQHPIPPSHQQQQPYAYTNT
HNPPASSSTMSAASGSRPANPAPGFQRVNEVIGGKVQEVFVIDDDTPPPANALSVQSARG
PHLVNNYAHVNGHAAAGAPYSSSLHGYASGSAADPRYDANVHLSKGKRKAHDNGTTERLS
AAHLNMLPHDADLIAPAPRSGLHGVTAEAPLPKRRKRSHPVKPDHMLSAGGTYDTSEAAT
AAAAHLVASGAPGMVPAKRHAPELVQARVPPNYRGGYPAGTGVLDYAARYDPAAASAAFA
HTHPPGYEGSASTRDSYASSASYVAAAAANNGPIDDDQGHFIVNEGDYVTSRYKILRLLG
QGTFGKVVECYDKRLRKYVAIKIIRAVQKYRDASQIEIRVLRTLRENDPGNDNRCIHLLE
TFNFKNHVCIVSELLGKSVFDFLKENKFQPFPSLHIWQFAKQLMQSVAFLHRLNLVHTDL
KPENILLVSSEHTVVATSRRQNAKRKHVLHNTEIRLIDFGSATFNDEFHSSVVSTRHYRA
PEIILSMGWSFPCDVWSIGCILVEFFTGDALFQTHDNLEHLAMMEAVLGKMPDDYRRKAE
TYKPEYFKHGALKYPLAETSKDSKKYVRQMKKLQDLIAPATSQSQYSKHNMRFLDLLRKL
LEFDAGKRIKVSEALKHPYFMLEEKDFPP
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggccacggtcgtgccacgcgccaaaaagcagaggacattacctgaccagctcatcggc
ctcaccccttcctcccttcaaggtgtcgatcccatcagcgtctccagcagtatgcttgca
caccagcatcccattcctccatcacatcaacagcagcaaccttacgcgtataccaacaca
cacaatccgcctgcttcttcctccaccatgtccgcagcaagcggcagcaggcccgcaaac
cctgctcctggctttcaaagagtcaatgaggtcatcggaggaaaggtccaagaagtcttt
gttatcgacgacgacactccaccaccagcaaacgcgctcagcgtccagtctgcacgcggc
ccgcatcttgtcaacaactacgcacacgtcaacggtcatgctgcagcaggcgctccttac
tcttcatcgctccacggatacgcttccggctccgccgccgatccacgctacgacgccaac
gtgcatctttccaaaggcaagcgtaaggcgcacgacaacggtaccactgaacgcctctct
gctgctcatctcaacatgttgccgcacgacgccgacttgattgcgcctgcacctcgctct
ggcctgcatggcgtaaccgccgaagctcccctaccgaagaggcgcaagcgaagtcatccc
gtcaagcctgaccacatgctttctgctggcggcacatatgataccagcgaggctgccaca
gccgcagcagcacacctcgtagcatccggcgcaccaggcatggtacccgccaaacggcat
gcacctgaattggtccaggcacgagtgccgcccaactaccgaggaggctatcccgcagga
acaggcgtgctcgactatgctgcacgctacgacccagcagctgccagtgccgcgtttgca
cacacacatccgccaggctacgagggcagcgctagcacacgtgattcgtacgccagctca
gcatcatacgtcgccgcagctgccgccaacaatggtcccattgacgacgatcagggtcac
tttatcgtcaacgagggtgactatgttacgagccgatacaagatcttgcggctactcggc
caaggcacgtttggcaaagtggtcgagtgctacgacaagaggctacgcaagtacgtcgcc
atcaagatcattcgtgcagtacaaaagtatcgcgatgcgagtcagatcgagatccgcgta
ctgcgtaccttgcgagaaaacgacccgggcaacgacaacagatgcatccatctgcttgag
acgttcaactttaagaatcacgtctgtatcgtttccgagctgttgggcaagagcgtgttc
gactttctcaaggagaacaagttccagccgtttccgtcgttgcatatttggcagtttgcc
aaacagctcatgcagagcgttgcgtttctgcatcgattgaacctggtgcacacggatctc
aagccggaaaatatcttgctggtgagcagcgagcataccgtggtggccacttcgaggcgg
cagaacgccaagaggaagcacgtgctgcacaacaccgagatccgtctgatcgactttggc
tctgcgacgttcaacgacgagtttcactcgtcggtagtgtccacacgccactatagagct
cccgagatcatcctgtccatgggctggtctttcccgtgcgacgtatggtcgatcggctgc
atcctcgtcgagttcttcaccggagacgcgctcttccagacgcacgacaacctggaacac
ttggccatgatggaagccgtgctggggaaaatgccggacgactaccgacgaaaagcggaa
acgtacaagccagagtactttaagcacggtgcgctcaagtatccgctcgccgagacaagc
aaggacagcaaaaagtacgtcagacagatgaagaagcttcaggacctcattgcgcccgca
acatcgcaatcgcagtacagcaagcacaacatgcgatttttggacctactgcgcaagctg
ttggagttcgatgcgggcaaaagaatcaaagtctcggaagcgctcaagcatccgtacttt
atgttggaggagaaagactttcctccgtga

DBGET integrated database retrieval system